TkA01G581970 | RubberDandelionOmics

Gene overview

TkA01G581970

Reference: TK1151 Chr: Chr01 Coordinates: 146452067-146454880 Strand: - Type: protein_coding

cDNA / CDS / Protein Sequences

Available sequence downloads CDS FASTA Protein FASTA cDNA FASTA

cDNA

1011 bp · TkA01G581970|TK1151|cDNA

ATGTGATCGTTTCTTTTTTTCAAGTTTTACTTAATTAAATTTTTGTTTGTTTGGGTGGTTTTTAGGATTGTGAATTGTGATAGGAAGCTATGGTGAGCATTCGTCGACAAAGATTGATCAAGCTTTATGGGAGAAGTCATTCTGTGGATTTCATATCATCATTTGAAAACAGACATTCTCCTAGTGGTTGGGTCCAAAATGGCAGACAGCTCAGCATGCATCTTACACCTTTGGTTGACCGATCTAGAGAGGAGAAAACA...

CDS

Download CDS FASTA

678 bp · TkA01G581970|TK1151|CDS

ATGGTGAGCATTCGTCGACAAAGATTGATCAAGCTTTATGGGAGAAGTCATTCTGTGGATTTCATATCATCATTTGAAAACAGACATTCTCCTAGTGGTTGGGTCCAAAATGGCAGACAGCTCAGCATGCATCTTACACCTTTGGTTGACCGATCTAGAGAGCAGGAGAAAACAAAGTCTGAAGAACCTGAATCCTCAAATGTTAATGAATCAAGCTCATCTAATAAGCAGCCATTTCAGCTTCCAGTGTTCAAAAGGCG...

Protein

Download Protein FASTA

225 aa · TkA01G581970|TK1151|PROTEIN

MVSIRRQRLIKLYGRSHSVDFISSFENRHSPSGWVQNGRQLSMHLTPLVDRSREQEKTKSEEPESSNVNESSSSNKQPFQLPVFKRRKRHRRKHFENQEPCIMRGVYYKNMKWQAAIKVDKKQIHLGTVGSQEEAARLYDRAAFMCGREPNFELTIDEKDELSKLSWDEFLTVTRSAINSKKHQRRVSSRMKFEHPSDNNDDHKAVEDEGGNSFSASDDAETSAS

Flanking Sequence Download

Sequence orientation and download details

Upstream/downstream are capped at 10000 bp per side. Negative-strand genes are reverse-complemented so the final FASTA follows transcriptional 5′→3′ orientation.

ID Mapping

Input ID	`TkA01G581970`
TK1151 ID	TkA01G581970
OH-1004 ID	LXL04_018660
Relationship / confidence	Multi Source To Oh1004 / Complex relationship
Protein identity (%)	64.300
Protein coverage (%)	TK1151 99.111 / OH-1004 74.917 Coverage and evidence Coverage is the aligned span of the best-scoring HSP divided by representative protein length. A homolog match does not establish functional validation.
Source version	TK1151 / GWHBCHF00000000

Open Full ID Mapping

SNP / Indel variants and carrier samplesCRA009020 · TK1151

Expand to load variant records for this gene.

Basic Information and Functional Annotation

Gene ID TkA01G581970

Location Chr01:146452067-146454880 (-)

Description Similar to At4g13040: Ethylene-responsive transcription factor-like protein At4g13040

Arabidopsis / Rice Reference Genes and Papers

Download references for this gene

Arabidopsis

Reference gene ID	Possible function	Papers / DOI
`At4g13040`	Probably acts as a transcriptional activator.	No verified direct reference in this release

Rice

No hit for this species in the current source table.

Functional annotation source

View annotation sources

Functional annotation source: OH1004 · LXL04_018660 · GCA_047496595.1_OSU_TarKok_2.0. These OH1004 annotations are retrieved through ID mapping; the Arabidopsis/rice table below uses protein alignments from the query reference.

GO annotations (OH1004 source)

GO:0006351 DNA-templated transcription Biological Process

GO:0009873 ethylene-activated signaling pathway Biological Process

GO:0010337 regulation of salicylic acid metabolic process Biological Process

GO:1900426 positive regulation of defense response to bacterium Biological Process

GO:0005634 nucleus Cellular Component

GO:0005739 mitochondrion Cellular Component

GO:0003677 DNA binding Molecular Function

GO:0003700 DNA-binding transcription factor activity Molecular Function

KEGG gene cross-reference

ath:AT4G13040

These KEGG gene identifiers are linked through homologous proteins; they do not establish pathway function for this gene.

Open Annotation Module

Gene expression

View expression in different studies, tissues and treatments. Results are presented separately by study and measurement unit.

View expression for this gene

Data sources and gene correspondence

Expression data come from public transcriptome studies. Reference genomes, sample metadata and measurement units are shown with the results. Ambiguous cross-reference correspondences do not select an expression record automatically; missing values do not mean zero expression.

Subcellular Localization Top 5

Computational predictions or homology annotations below do not replace localization experiments.

Nucleus0.932

Rank 1 · TkA01G581970 · TK1151

Cytoplasm0.110

Rank 2 · TkA01G581970 · TK1151

Cell membrane0.032

Rank 3 · TkA01G581970 · TK1151

Plastid0.023

Rank 4 · TkA01G581970 · TK1151

Endoplasmic reticulum0.020

Rank 5 · TkA01G581970 · TK1151

LocPro · Direct prediction · Computational prediction, not experimental localization

Open Subcellular Module

Predicted Functional Domains

Domain results are from Pfam-A/HMMER; positions are amino-acid coordinates on the protein sequence.

PF00847AP288-93 aa

PF02115Rho_GDI102-135 aa

PF00847AP2104-145 aa

PF02115Rho_GDI144-166 aa

PF00847AP2166-188 aa

Gene ID	Domain ID	Domain Name	Start aa	End aa	E-value	Score
TkA01G581970	`PF00847`	AP2	88	93	2e-05	25.5
TkA01G581970	`PF02115`	Rho_GDI	102	135	0.0013	19.1
TkA01G581970	`PF00847`	AP2	104	145	2e-05	25.5
TkA01G581970	`PF02115`	Rho_GDI	144	166	0.0013	19.1
TkA01G581970	`PF00847`	AP2	166	188	2e-05	25.5

Arabidopsis / Rice Protein Homology

Only Arabidopsis and rice are shown. Swiss-Prot entries are reviewed; TrEMBL entries are supplementary sequence candidates. Similarity is not experimental validation.

Download current result

Protein	Organism	Description	Identity	Database	Confidence
`Q56XP9`	Arabidopsis thaliana	sp\|Q56XP9\|ERFL1_ARATH Ethylene-responsive transcription factor-like protein At4g13040	48.800%	Swiss-Prot	Medium

JBrowse

View in Genome Browser

Gene Card