TkA01G506860 | RubberDandelionOmics

Gene overview

TkA01G506860

Reference: TK1151 Chr: Chr01 Coordinates: 126926746-126933479 Strand: + Type: protein_coding

cDNA / CDS / Protein Sequences

Available sequence downloads CDS FASTA Protein FASTA cDNA FASTA

cDNA

5781 bp · TkA01G506860|TK1151|cDNA

CCAGCCACAACCAAACAAGCACTTGTAGAGATAGAAAGAGAAAGAGAAAGAGAAAGAGAGATTAAAAAGCAAAGGCGCCTCTTTTCCCCCCTATCTTTTTAATCATGACCCCTTCCTTCTCTCTCCTTATGTGAAAAAAGGTTCGTTCTTGATGCCTCTTTATGCTCCCCTCAGGTTTTGGTGAGGCAGGCATACCTCCGAATAGGATATTTATTTACATTACTCCCCTTGTTCTCTCTTCTTCTCATTTCTTGTCTTTT...

CDS

Download CDS FASTA

3447 bp · TkA01G506860|TK1151|CDS

ATGATTTTTTCTGCCGTTTTTGACTTCTCGAGGCCTTTTGTAAACTGGGTGTTTGTTGCAATGTCTTTGAATTCCAAGATTTCTGGGTTAAATGGTAAATTGATGAACAGTTCGAAGATGAGGAAGACTAAGGAGCCTTTGAGAGGATCTCGTAGTGGCTGGAAAAGGAAAAAGTTTCTCGTTTTTGTGTGGGTTTTACTTGTTGTCATTGGGTTTGGTTTATTTTTATCCAGCTGTGTTTTGAGGAAGAAGATGGAGGT...

Protein

Download Protein FASTA

1148 aa · TkA01G506860|TK1151|PROTEIN

MIFSAVFDFSRPFVNWVFVAMSLNSKISGLNGKLMNSSKMRKTKEPLRGSRSGWKRKKFLVFVWVLLVVIGFGLFLSSCVLRKKMEVTGTCEDKSLLLVEQFNVSKEHLHELASSFFESDQITSFKCIKQMGYETSRKSEITCALTAPNPAETVELWGQCPVDHGDTPMVLEKLTIEHYNSAMKVTLLALFVLALCVVILWKNRKGKLKKKEQALTSSKGAGKWMKKLLVLFVLTGIIVSIWWFWYLNKGTRIRRKETLE...

Flanking Sequence Download

Sequence orientation and download details

Upstream/downstream are capped at 10000 bp per side. Negative-strand genes are reverse-complemented so the final FASTA follows transcriptional 5′→3′ orientation.

ID Mapping

Input ID	`TkA01G506860`
TK1151 ID	TkA01G506860
OH-1004 ID	LXL04_022485
Relationship / confidence	Multi Source To Oh1004 / Complex relationship
Protein identity (%)	55.200
Protein coverage (%)	TK1151 80.226 / OH-1004 95.073 Coverage and evidence Coverage is the aligned span of the best-scoring HSP divided by representative protein length. A homolog match does not establish functional validation.
Source version	TK1151 / GWHBCHF00000000

Open Full ID Mapping

SNP / Indel variants and carrier samplesCRA009020 · TK1151

Expand to load variant records for this gene.

Basic Information and Functional Annotation

Gene ID TkA01G506860

Location Chr01:126926746-126933479 (+)

Description Similar to AHK4: Histidine kinase 4

Arabidopsis / Rice Reference Genes and Papers

Download references for this gene

Arabidopsis

Reference gene ID	Possible function	Papers / DOI
`At5g35750`	Cytokinins (CK) receptor related to bacterial two-component regulators.	Histidine kinase homologs that act as cytokinin receptors possess overlapping functions in the regulation of shoot and root growth in Arabidopsis.2004 · DOI: 10.1105/tpc.021477 In planta functions of the Arabidopsis cytokinin receptor family.2004 · DOI: 10.1073/pnas.0402887101 Arabidopsis cytokinin receptor mutants reveal functions in shoot growth, leaf senescence, seed size, germination, root development, and cytokinin metabolism.2006 · DOI: 10.1105/tpc.105.037796 Cytokinins regulate a bidirectional phosphorelay network in Arabidopsis.2006 · DOI: 10.1016/j.cub.2006.04.030 Identification of amino acid substitutions that render the Arabidopsis cytokinin receptor histidine kinase AHK4 constitutively active.2007 · DOI: 10.1093/pcp/pcm145 Cytokinin receptors are involved in alkamide regulation of root and shoot development in Arabidopsis.2007 · DOI: 10.1104/pp.107.107953 Functional analysis of AHK1/ATHK1 and cytokinin receptor histidine kinases in response to abscisic acid, drought, and salt stress in Arabidopsis.2007 · DOI: 10.1073/pnas.0706547105 The role of auxins and cytokinins in the mutualistic interaction between Arabidopsis and Piriformospora indica.2008 · DOI: 10.1094/mpmi-21-10-1371 The histidine kinases CYTOKININ-INDEPENDENT1 and ARABIDOPSIS HISTIDINE KINASE2 and 3 regulate vascular tissue development in Arabidopsis shoots.2009 · DOI: 10.1105/tpc.109.066696 Cytokinin overproduction-caused alteration of flower development is partially mediated by CUC2 and CUC3 in Arabidopsis.2010 · DOI: 10.1016/j.gene.2009.11.003 A subset of cytokinin two-component signaling system plays a role in cold temperature stress response in Arabidopsis.2010 · DOI: 10.1074/jbc.m109.096644
`At1g27320`	Cytokinins (CK) receptor related to bacterial two-component regulators.	Novel family of sensor histidine kinase genes in Arabidopsis thaliana.2001 · DOI: 10.1093/pcp/pce015 The Arabidopsis AHK4 histidine kinase is a cytokinin-binding receptor that transduces cytokinin signals across the membrane.2001 · DOI: 10.1093/pcp/pce127 Histidine kinase homologs that act as cytokinin receptors possess overlapping functions in the regulation of shoot and root growth in Arabidopsis.2004 · DOI: 10.1105/tpc.021477 In planta functions of the Arabidopsis cytokinin receptor family.2004 · DOI: 10.1073/pnas.0402887101 Two cytokinin receptors of Arabidopsis thaliana, CRE1/AHK4 and AHK3, differ in their ligand specificity in a bacterial assay.2004 · DOI: 10.1093/pcp/pch132 Interaction between phosphate-starvation, sugar, and cytokinin signaling in Arabidopsis and the roles of cytokinin receptors CRE1/AHK4 and AHK3.2005 · DOI: 10.1104/pp.105.060517 Arabidopsis cytokinin receptor mutants reveal functions in shoot growth, leaf senescence, seed size, germination, root development, and cytokinin metabolism.2006 · DOI: 10.1105/tpc.105.037796 Cytokinin-mediated control of leaf longevity by AHK3 through phosphorylation of ARR2 in Arabidopsis.2006 · DOI: 10.1073/pnas.0505150103 Cytokinins regulate a bidirectional phosphorelay network in Arabidopsis.2006 · DOI: 10.1016/j.cub.2006.04.030 Biochemical characteristics and ligand-binding properties of Arabidopsis cytokinin receptor AHK3 compared to CRE1/AHK4 as revealed by a direct binding assay.2006 · DOI: 10.1093/jxb/erl179 Identification of amino acid substitutions that render the Arabidopsis cytokinin receptor histidine kinase AHK4 constitutively active.2007 · DOI: 10.1093/pcp/pcm145 Cytokinin receptors are involved in alkamide regulation of root and shoot development in Arabidopsis.2007 · DOI: 10.1104/pp.107.107953 Functional analysis of AHK1/ATHK1 and cytokinin receptor histidine kinases in response to abscisic acid, drought, and salt stress in Arabidopsis.2007 · DOI: 10.1073/pnas.0706547105 Cytokinins negatively regulate the root iron uptake machinery in Arabidopsis through a growth-dependent pathway.2008 · DOI: 10.1111/j.1365-313x.2008.03502.x Mechanism-based inhibitors of cytokinin oxidase/dehydrogenase attack FAD cofactor.2008 · DOI: 10.1016/j.jmb.2008.05.044 The histidine kinases CYTOKININ-INDEPENDENT1 and ARABIDOPSIS HISTIDINE KINASE2 and 3 regulate vascular tissue development in Arabidopsis shoots.2009 · DOI: 10.1105/tpc.109.066696 Cytokinin overproduction-caused alteration of flower development is partially mediated by CUC2 and CUC3 in Arabidopsis.2010 · DOI: 10.1016/j.gene.2009.11.003 A subset of cytokinin two-component signaling system plays a role in cold temperature stress response in Arabidopsis.2010 · DOI: 10.1074/jbc.m109.096644

Rice

Reference gene ID	Possible function	Papers / DOI
`Os10g0362300`	Cytokinin receptor related to bacterial two-component regulators.	No verified direct reference in this release
`UniProt: A2WYI4`	Cytokinin receptor related to bacterial two-component regulators.	No verified direct reference in this release
`Os01g0923700`	Cytokinin receptor related to bacterial two-component regulators.	No verified direct reference in this release

Functional annotation source

View annotation sources

Functional annotation source: OH1004 · LXL04_022485 · GCA_047496595.1_OSU_TarKok_2.0. These OH1004 annotations are retrieved through ID mapping; the Arabidopsis/rice table below uses protein alignments from the query reference.

GO annotations (OH1004 source)

GO:0000160 phosphorelay signal transduction system Biological Process

GO:0006468 protein phosphorylation Biological Process

GO:0006970 response to osmotic stress Biological Process

GO:0007231 osmosensory signaling pathway Biological Process

GO:0009414 response to water deprivation Biological Process

GO:0009636 response to toxic substance Biological Process

GO:0009651 response to salt stress Biological Process

GO:0009736 cytokinin-activated signaling pathway Biological Process

GO:0009737 response to abscisic acid Biological Process

GO:0009909 regulation of flower development Biological Process

GO:0010029 regulation of seed germination Biological Process

GO:0010086 embryonic root morphogenesis Biological Process

KEGG gene cross-reference

ath:AT2G01830

ath:AT5G35750

dosa:Os03g0717700

mtr:11411168

osa:107275680

These KEGG gene identifiers are linked through homologous proteins; they do not establish pathway function for this gene.

Open Annotation Module

Gene expression

View expression in different studies, tissues and treatments. Results are presented separately by study and measurement unit.

View expression for this gene

Data sources and gene correspondence

Expression data come from public transcriptome studies. Reference genomes, sample metadata and measurement units are shown with the results. Ambiguous cross-reference correspondences do not select an expression record automatically; missing values do not mean zero expression.

Subcellular Localization Top 5

Computational predictions or homology annotations below do not replace localization experiments.

Endoplasmic reticulum0.445

Rank 1 · TkA01G506860 · TK1151

Golgi apparatus0.189

Rank 2 · TkA01G506860 · TK1151

Cell membrane0.183

Rank 3 · TkA01G506860 · TK1151

Cytoplasm0.144

Rank 4 · TkA01G506860 · TK1151

Nucleus0.117

Rank 5 · TkA01G506860 · TK1151

LocPro · Direct prediction · Computational prediction, not experimental localization

Open Subcellular Module

Predicted Functional Domains

Domain results are from Pfam-A/HMMER; positions are amino-acid coordinates on the protein sequence.

PF07331TctB43-75 aa

PF17561TssO54-79 aa

PF04932Wzy_C54-76 aa

PF28887PilO_N57-103 aa

PF13273DUF406457-89 aa

PF13589HATPase_c_371-109 aa

PF24896Receiver_CRE183-123 aa

PF17561TssO177-218 aa

Gene ID	Domain ID	Domain Name	Start aa	End aa	E-value	Score
TkA01G506860	`PF07331`	TctB	43	75	0.6	11.0
TkA01G506860	`PF17561`	TssO	54	79	0.14	12.8
TkA01G506860	`PF04932`	Wzy_C	54	76	0.51	10.9
TkA01G506860	`PF28887`	PilO_N	57	103	0.0063	17.1
TkA01G506860	`PF13273`	DUF4064	57	89	0.53	11.2
TkA01G506860	`PF13589`	HATPase_c_3	71	109	0.0013	19.5
TkA01G506860	`PF24896`	Receiver_CRE1	83	123	3.2e-27	96.1
TkA01G506860	`PF17561`	TssO	177	218	0.14	12.8
TkA01G506860	`PF28423`	Epiregulin_C	183	213	1.2	9.6
TkA01G506860	`PF28887`	PilO_N	185	215	0.0063	17.1
TkA01G506860	`PF04932`	Wzy_C	187	261	0.51	10.9
TkA01G506860	`PF13273`	DUF4064	187	241	0.53	11.2
TkA01G506860	`PF07331`	TctB	190	245	0.6	11.0
TkA01G506860	`PF28887`	PilO_N	225	260	0.0063	17.1
TkA01G506860	`PF17561`	TssO	226	290	0.14	12.8
TkA01G506860	`PF28423`	Epiregulin_C	228	252	1.2	9.6

Arabidopsis / Rice Protein Homology

Only Arabidopsis and rice are shown. Swiss-Prot entries are reviewed; TrEMBL entries are supplementary sequence candidates. Similarity is not experimental validation.

Download current result

Protein	Organism	Description	Identity	Database	Confidence
`Q9C5U2`	Arabidopsis thaliana	sp\|Q9C5U2\|AHK2_ARATH Histidine kinase 2	60.600%	Swiss-Prot	High
`Q9C5U1`	Arabidopsis thaliana	sp\|Q9C5U1\|AHK3_ARATH Histidine kinase 3	57.800%	Swiss-Prot	High
`A1A697`	Oryza sativa subsp. japonica	sp\|A1A697\|OHK5_ORYSJ Probable histidine kinase 5	56.900%	Swiss-Prot	High
`A2WYI4`	Oryza sativa subsp. indica	sp\|A2WYI4\|OHK3_ORYSI Probable histidine kinase 3	54.700%	Swiss-Prot	High
`A1A696`	Oryza sativa subsp. japonica	sp\|A1A696\|OHK3_ORYSJ Probable histidine kinase 3	54.700%	Swiss-Prot	High

JBrowse

View in Genome Browser

Gene Card