TkA01G505230 | RubberDandelionOmics

Gene overview

TkA01G505230

Reference: TK1151 Chr: Chr01 Coordinates: 126497399-126498037 Strand: - Type: protein_coding

cDNA / CDS / Protein Sequences

Available sequence downloads CDS FASTA Protein FASTA cDNA FASTA

cDNA

639 bp · TkA01G505230|TK1151|cDNA

ATGAACATCGTCAAGACTCCTTCACCTGGACAAAATCGAAAAATCTTTGTCGGAGGTTTAGCGTCGACAGTCACGGAAAACGAATTCAAGATGTATTTTAACCAATATGGAAACGTTACGGATGCTGTAGTTATGTACGATCATAATACAAAAAGACCCAGAGGTTTCGGTTTCATAACATACGACTCACAAGAAGCAATCAACAATGTCTTACTAAAAACACTTCACCAATTAAACGGAAAAACGGTTGAAGTCAAACG...

CDS

Download CDS FASTA

639 bp · TkA01G505230|TK1151|CDS

ATGAACATCGTCAAGACTCCTTCACCTGGACAAAATCGAAAAATCTTTGTCGGAGGTTTAGCGTCGACAGTCACGGAAAACGAATTCAAGATGTATTTTAACCAATATGGAAACGTTACGGATGCTGTAGTTATGTACGATCATAATACAAAAAGACCCAGAGGTTTCGGTTTCATAACATACGACTCACAAGAAGCAATCAACAATGTCTTACTAAAAACACTTCACCAATTAAACGGAAAAACGGTTGAAGTCAAACG...

Protein

Download Protein FASTA

212 aa · TkA01G505230|TK1151|PROTEIN

MNIVKTPSPGQNRKIFVGGLASTVTENEFKMYFNQYGNVTDAVVMYDHNTKRPRGFGFITYDSQEAINNVLLKTLHQLNGKTVEVKRAVPKELSPGPTPTRTTHSPYPYSNSINGYNTQGPIGGYNVKMGLNFEPNRLSPYFGDSISYDNSGNENNVSFFSSNLWGNGRFDGIGSMVSPQNGGNERRNTSGRGYDAPFLDFYGGGGGSGDLT

Flanking Sequence Download

Sequence orientation and download details

Upstream/downstream are capped at 10000 bp per side. Negative-strand genes are reverse-complemented so the final FASTA follows transcriptional 5′→3′ orientation.

ID Mapping

Input ID	`TkA01G505230`
TK1151 ID	TkA01G505230
OH-1004 ID	LXL04_031022
Relationship / confidence	Multi Source To Oh1004 / Complex relationship
Protein identity (%)	50.000
Protein coverage (%)	TK1151 87.736 / OH-1004 40.476 Coverage and evidence Coverage is the aligned span of the best-scoring HSP divided by representative protein length. A homolog match does not establish functional validation.
Source version	TK1151 / GWHBCHF00000000

Open Full ID Mapping

SNP / Indel variants and carrier samplesCRA009020 · TK1151

Expand to load variant records for this gene.

Basic Information and Functional Annotation

Gene ID TkA01G505230

Location Chr01:126497399-126498037 (-)

Description Similar to RNP1: Heterogeneous nuclear ribonucleoprotein 1

Arabidopsis / Rice Reference Genes and Papers

Download references for this gene

Arabidopsis

Reference gene ID	Possible function	Papers / DOI
`At4g14300`	Involved with pre-mRNA processing.	No verified direct reference in this release
`At1g58470`	RNA binding protein.	An RNA-binding protein, AtRBP1, is expressed in actively proliferative regions in Arabidopsis thaliana.2000 · DOI: 10.1093/pcp/41.3.282

Rice

No hit for this species in the current source table.

Functional annotation source

View annotation sources

Functional annotation source: OH1004 · LXL04_031022 · GCA_047496595.1_OSU_TarKok_2.0. These OH1004 annotations are retrieved through ID mapping; the Arabidopsis/rice table below uses protein alignments from the query reference.

GO annotations (OH1004 source)

GO:0006397 mRNA processing Biological Process

GO:0006417 regulation of translation Biological Process

GO:0008380 RNA splicing Biological Process

GO:0010228 vegetative to reproductive phase transition of meristem Biological Process

GO:0048864 stem cell development Biological Process

GO:0051028 mRNA transport Biological Process

GO:1901000 regulation of response to salt stress Biological Process

GO:2000070 regulation of response to water deprivation Biological Process

GO:0005634 nucleus Cellular Component

GO:0005681 spliceosomal complex Cellular Component

GO:0005737 cytoplasm Cellular Component

GO:0005829 cytosol Cellular Component

KEGG gene cross-reference

ath:AT4G14300

hsa:124540

mmu:76626

These KEGG gene identifiers are linked through homologous proteins; they do not establish pathway function for this gene.

Open Annotation Module

Gene expression

View expression in different studies, tissues and treatments. Results are presented separately by study and measurement unit.

View expression for this gene

Data sources and gene correspondence

Expression data come from public transcriptome studies. Reference genomes, sample metadata and measurement units are shown with the results. Ambiguous cross-reference correspondences do not select an expression record automatically; missing values do not mean zero expression.

Subcellular Localization Top 5

Computational predictions or homology annotations below do not replace localization experiments.

Cytoplasm0.606

Rank 1 · TkA01G505230 · TK1151

Nucleus0.452

Rank 2 · TkA01G505230 · TK1151

Cell membrane0.046

Rank 3 · TkA01G505230 · TK1151

Mitochondrion0.039

Rank 4 · TkA01G505230 · TK1151

Lysosome / Vacuole0.036

Rank 5 · TkA01G505230 · TK1151

LocPro · Direct prediction · Computational prediction, not experimental localization

Open Subcellular Module

Predicted Functional Domains

Domain results are from Pfam-A/HMMER; positions are amino-acid coordinates on the protein sequence.

PF16367RRM_713-82 aa

PF23085RRM_PARP14_314-86 aa

PF00076RRM_115-72 aa

PF28441RRM_1119-93 aa

PF24343OB_DEPS-1_1st37-96 aa

PF24343OB_DEPS-1_1st140-157 aa

Gene ID	Domain ID	Domain Name	Start aa	End aa	E-value	Score
TkA01G505230	`PF16367`	RRM_7	13	82	2.3e-07	31.4
TkA01G505230	`PF23085`	RRM_PARP14_3	14	86	0.00011	22.9
TkA01G505230	`PF00076`	RRM_1	15	72	4.9e-16	59.1
TkA01G505230	`PF28441`	RRM_11	19	93	0.025	15.6
TkA01G505230	`PF24343`	OB_DEPS-1_1st	37	96	0.27	12.7
TkA01G505230	`PF24343`	OB_DEPS-1_1st	140	157	0.27	12.7

Arabidopsis / Rice Protein Homology

Only Arabidopsis and rice are shown. Swiss-Prot entries are reviewed; TrEMBL entries are supplementary sequence candidates. Similarity is not experimental validation.

Download current result

Protein	Organism	Description	Identity	Database	Confidence
`Q8W034`	Arabidopsis thaliana	sp\|Q8W034\|RNP1_ARATH Heterogeneous nuclear ribonucleoprotein 1	58.100%	Swiss-Prot	Low
`Q9C652`	Arabidopsis thaliana	sp\|Q9C652\|RBP1_ARATH RNA-binding protein 1	57.300%	Swiss-Prot	Low

JBrowse

View in Genome Browser

Gene Card