TkA01G488980 | RubberDandelionOmics

Gene overview

TkA01G488980

Reference: TK1151 Chr: Chr01 Coordinates: 122357811-122363225 Strand: + Type: protein_coding

cDNA / CDS / Protein Sequences

Available sequence downloads CDS FASTA Protein FASTA cDNA FASTA

cDNA

2687 bp · TkA01G488980|TK1151|cDNA

CCTCTCTCAATATTATTATTTTATCATTATTATTTCTTTAGAAATGGAATCAAATGATTAAAATGAATAAAATATTGCAGAAAATGATTTTAATTCAAAAGAATACTCCCTCGTTGAAAAGCACGGGAAACAACAAGCAACAAGAGAGAGCTCCTCCGTCGAACTCCATCGTCCCCTTCTTTCAAACCCTTTTCAAATCCCTCTTTCCCGTTTTCAAGCTCTCTGCAAACCCTAGCCATGCCGCTCACTATCACCCTCTC...

CDS

Download CDS FASTA

1854 bp · TkA01G488980|TK1151|CDS

ATGGCTGCCGGAAAGGGAGGTTTGTTTTTAGACAAGATATGGAGATTCGTGCGGACGATGTATTTCATGGTGGTTATGGTGTCCTCGTTATTGGTGTTATCGCTTCCTATTCTGGTAGCAATTGGTGATATTTTGGTTCCTAGTGTTCTGATTTCGAACTTTACCTGCGTTAGATGCTACAGCTTCAAACAGCATTTGAATAGATATTCTTTTAGAAGTTCGTTGACCGACGTTCCCGTGGTTTCAGTCGTCAGATCTCT...

Protein

Download Protein FASTA

617 aa · TkA01G488980|TK1151|PROTEIN

MAAGKGGLFLDKIWRFVRTMYFMVVMVSSLLVLSLPILVAIGDILVPSVLISNFTCVRCYSFKQHLNRYSFRSSLTDVPVVSVVRSLIITCVYMICEGPVLSHGQYLGTVTLCSAFSVLLLSIKVCIFTVNSQLEAEASSSPSRQRLHLKKSWGMPVLFLSSVVFALGHTVIAYRASCRARRKLMLHRIDPESVLSTKLLFTSGYAKVPRSPTPTAGRTPKSDSEIRRKPNWQNRNDGELPVRLLADVDSLFMSCPRVSV...

Flanking Sequence Download

Sequence orientation and download details

Upstream/downstream are capped at 10000 bp per side. Negative-strand genes are reverse-complemented so the final FASTA follows transcriptional 5′→3′ orientation.

ID Mapping

Input ID	`TkA01G488980`
TK1151 ID	TkA01G488980
OH-1004 ID	LXL04_032093
Relationship / confidence	Multi Source To Oh1004 / Complex relationship
Protein identity (%)	74.000
Protein coverage (%)	TK1151 99.676 / OH-1004 99.195 Coverage and evidence Coverage is the aligned span of the best-scoring HSP divided by representative protein length. A homolog match does not establish functional validation.
Source version	TK1151 / GWHBCHF00000000

Open Full ID Mapping

SNP / Indel variants and carrier samplesCRA009020 · TK1151

Expand to load variant records for this gene.

Basic Information and Functional Annotation

Gene ID	`TkA01G488980`
Location	Chr01:122357811-122363225 (+)
Description	Similar to yugF: Uncharacterized hydrolase YugF (Bacillus subtilis (strain 168)
Arabidopsis / Rice Reference Genes and Papers	Download references for this gene Arabidopsis No hit for this species in the current source table. Rice No hit for this species in the current source table.
Functional annotation source	View annotation sources Functional annotation source: OH1004 · `LXL04_032093` · GCA_047496595.1_OSU_TarKok_2.0. These OH1004 annotations are retrieved through ID mapping; the Arabidopsis/rice table below uses protein alignments from the query reference.
GO annotations (OH1004 source)	GO:0045150 acetoin catabolic process Biological Process GO:0016020 membrane Cellular Component GO:0004742 dihydrolipoyllysine-residue acetyltransferase activity Molecular Function GO:0052689 carboxylic ester hydrolase activity Molecular Function
KEGG gene cross-reference	bsu:BSU31420 These KEGG gene identifiers are linked through homologous proteins; they do not establish pathway function for this gene.

Open Annotation Module

Gene expression

View expression in different studies, tissues and treatments. Results are presented separately by study and measurement unit.

View expression for this gene

Data sources and gene correspondence

Expression data come from public transcriptome studies. Reference genomes, sample metadata and measurement units are shown with the results. Ambiguous cross-reference correspondences do not select an expression record automatically; missing values do not mean zero expression.

Subcellular Localization Top 5

Computational predictions or homology annotations below do not replace localization experiments.

Endoplasmic reticulum0.387

Rank 1 · TkA01G488980 · TK1151

Golgi apparatus0.204

Rank 2 · TkA01G488980 · TK1151

Nucleus0.192

Rank 3 · TkA01G488980 · TK1151

Cytoplasm0.184

Rank 4 · TkA01G488980 · TK1151

Cell membrane0.160

Rank 5 · TkA01G488980 · TK1151

LocPro · Direct prediction · Computational prediction, not experimental localization

Open Subcellular Module

Predicted Functional Domains

Domain results are from Pfam-A/HMMER; positions are amino-acid coordinates on the protein sequence.

PF10230LIDHydrolase6-39 aa

PF10457MENTAL61-132 aa

PF07819PGAP1347-368 aa

PF00561Abhydrolase_1348-598 aa

PF12697Abhydrolase_6348-605 aa

PF12146Hydrolase_4348-598 aa

PF10230LIDHydrolase396-463 aa

PF07819PGAP1418-460 aa

Gene ID	Domain ID	Domain Name	Start aa	End aa	E-value	Score
TkA01G488980	`PF10230`	LIDHydrolase	6	39	0.13	12.6
TkA01G488980	`PF10457`	MENTAL	61	132	0.0008	19.9
TkA01G488980	`PF07819`	PGAP1	347	368	0.52	10.7
TkA01G488980	`PF00561`	Abhydrolase_1	348	598	9.5e-21	75.3
TkA01G488980	`PF12697`	Abhydrolase_6	348	605	1.4e-20	75.6
TkA01G488980	`PF12146`	Hydrolase_4	348	598	1.6e-07	31.6
TkA01G488980	`PF10230`	LIDHydrolase	396	463	0.13	12.6
TkA01G488980	`PF07819`	PGAP1	418	460	0.52	10.7
TkA01G488980	`PF07859`	Abhydrolase_3	420	459	0.045	14.2
TkA01G488980	`PF12695`	Abhydrolase_5	422	458	0.27	11.7
TkA01G488980	`PF06821`	Ser_hydrolase	423	460	0.021	15.5
TkA01G488980	`PF22226`	Mre11_C	511	530	0.21	12.5
TkA01G488980	`PF06821`	Ser_hydrolase	550	597	0.021	15.5
TkA01G488980	`PF08386`	Abhydrolase_4	551	599	0.0043	17.9
TkA01G488980	`PF07819`	PGAP1	552	580	0.52	10.7
TkA01G488980	`PF12695`	Abhydrolase_5	553	593	0.27	11.7

Arabidopsis / Rice Protein Homology

Only Arabidopsis and rice are shown. Swiss-Prot entries are reviewed; TrEMBL entries are supplementary sequence candidates. Similarity is not experimental validation.

Download current result

No result was found for this query.

JBrowse

View in Genome Browser

Gene Card