TkA01G485200 | RubberDandelionOmics

Gene overview

TkA01G485200

Reference: TK1151 Chr: Chr01 Coordinates: 121449918-121450835 Strand: + Type: protein_coding

cDNA / CDS / Protein Sequences

Available sequence downloads CDS FASTA Protein FASTA cDNA FASTA

cDNA

918 bp · TkA01G485200|TK1151|cDNA

ATGAGCTTCTCCAAACTTTCAATTACTCTTTTAATTCTACAAGTGCTTTTAACGGCCGCATCAACACAACATGAAACCGCACCAAAATCAGACCTATTCCGTGAATATATCGGAGCAGAATTCAACGGCGTTAAATTTACAGACCTCCCCATAAACCCTAATGTCGATTTCCATTACATACTTGCATTTGCAATCGATTACACCACTTCATCTTCTCCATCCCCAACCAACGGTAAATTCAATGTGTTCTGGGATACAGA...

CDS

Download CDS FASTA

918 bp · TkA01G485200|TK1151|CDS

ATGAGCTTCTCCAAACTTTCAATTACTCTTTTAATTCTACAAGTGCTTTTAACGGCCGCATCAACACAACATGAAACCGCACCAAAATCAGACCTATTCCGTGAATATATCGGAGCAGAATTCAACGGCGTTAAATTTACAGACCTCCCCATAAACCCTAATGTCGATTTCCATTACATACTTGCATTTGCAATCGATTACACCACTTCATCTTCTCCATCCCCAACCAACGGTAAATTCAATGTGTTCTGGGATACAGA...

Protein

Download Protein FASTA

305 aa · TkA01G485200|TK1151|PROTEIN

MSFSKLSITLLILQVLLTAASTQHETAPKSDLFREYIGAEFNGVKFTDLPINPNVDFHYILAFAIDYTTSSSPSPTNGKFNVFWDTDNLSPSQVSSIKSQHSNVKVALSLGGDSVGGGSCYFTPSSIDSWVSNAVSSLTKIIQEYNLDGIDIDYEHFHSDPDTFSECIGKLVTTLKNNGVISFASIAPFDDDEVQSHYLALWKKYAHIIDYVNFQFYAYDEGTTVSQFMNYFKTQSSNYKGGSILASIATDGSGGLSPEN...

Flanking Sequence Download

Sequence orientation and download details

Upstream/downstream are capped at 10000 bp per side. Negative-strand genes are reverse-complemented so the final FASTA follows transcriptional 5′→3′ orientation.

ID Mapping

Input ID	`TkA01G485200`
TK1151 ID	TkA01G485200
OH-1004 ID	LXL04_002062
Relationship / confidence	Multi Candidate From Tk1151 / Complex relationship
Protein identity (%)	99.000
Protein coverage (%)	TK1151 100.000 / OH-1004 100.000 Coverage and evidence Coverage is the aligned span of the best-scoring HSP divided by representative protein length. A homolog match does not establish functional validation.
Source version	TK1151 / GWHBCHF00000000

Open Full ID Mapping

SNP / Indel variants and carrier samplesCRA009020 · TK1151

Expand to load variant records for this gene.

Basic Information and Functional Annotation

Gene ID	`TkA01G485200`
Location	Chr01:121449918-121450835 (+)
Description	Similar to Chitinase 2
Arabidopsis / Rice Reference Genes and Papers	Download references for this gene Arabidopsis No hit for this species in the current source table. Rice No hit for this species in the current source table.
Functional annotation source	View annotation sources Functional annotation source: OH1004 · `LXL04_002062` · GCA_047496595.1_OSU_TarKok_2.0. These OH1004 annotations are retrieved through ID mapping; the Arabidopsis/rice table below uses protein alignments from the query reference.
GO annotations (OH1004 source)	GO:0000272 polysaccharide catabolic process Biological Process GO:0005975 carbohydrate metabolic process Biological Process GO:0006032 chitin catabolic process Biological Process GO:0008061 chitin binding Molecular Function GO:0008843 endochitinase activity Molecular Function GO:0016798 hydrolase activity, acting on glycosyl bonds Molecular Function
KEGG gene cross-reference	gmx:547969 These KEGG gene identifiers are linked through homologous proteins; they do not establish pathway function for this gene.

Open Annotation Module

Gene expression

View expression in different studies, tissues and treatments. Results are presented separately by study and measurement unit.

View expression for this gene

Data sources and gene correspondence

Expression data come from public transcriptome studies. Reference genomes, sample metadata and measurement units are shown with the results. Ambiguous cross-reference correspondences do not select an expression record automatically; missing values do not mean zero expression.

Subcellular Localization Top 5

Computational predictions or homology annotations below do not replace localization experiments.

Extracellular0.649

Rank 1 · TkA01G485200 · TK1151

Cytoplasm0.124

Rank 2 · TkA01G485200 · TK1151

Lysosome / Vacuole0.079

Rank 3 · TkA01G485200 · TK1151

Endoplasmic reticulum0.077

Rank 4 · TkA01G485200 · TK1151

Cell membrane0.054

Rank 5 · TkA01G485200 · TK1151

LocPro · Direct prediction · Computational prediction, not experimental localization

Open Subcellular Module

Predicted Functional Domains

Domain results are from Pfam-A/HMMER; positions are amino-acid coordinates on the protein sequence.

PF00704Glyco_hydro_1885-221 aa

PF23916TIM-barrel_EndoS132-233 aa

PF29713HHH_RS2-RL21-YNQ2170-196 aa

PF00704Glyco_hydro_18269-284 aa

Gene ID	Domain ID	Domain Name	Start aa	End aa	E-value	Score
TkA01G485200	`PF00704`	Glyco_hydro_18	85	221	2.5e-15	57.7
TkA01G485200	`PF23916`	TIM-barrel_EndoS	132	233	1.4e-06	28.9
TkA01G485200	`PF29713`	HHH_RS2-RL21-YNQ2	170	196	0.15	13.2
TkA01G485200	`PF00704`	Glyco_hydro_18	269	284	2.5e-15	57.7

Arabidopsis / Rice Protein Homology

Only Arabidopsis and rice are shown. Swiss-Prot entries are reviewed; TrEMBL entries are supplementary sequence candidates. Similarity is not experimental validation.

Download current result

No result was found for this query.

JBrowse

View in Genome Browser

Gene Card