TkA01G463030 | RubberDandelionOmics

Gene overview

TkA01G463030

Reference: TK1151 Chr: Chr01 Coordinates: 116037968-116041559 Strand: - Type: protein_coding

cDNA / CDS / Protein Sequences

Available sequence downloads CDS FASTA Protein FASTA cDNA FASTA

cDNA

1131 bp · TkA01G463030|TK1151|cDNA

CGGGTCGAATACCGCTGCGAAGTTTCCAGATTACGAAATTCGTCTACATTTCGATGGGAAGTTATTTATGAACTAGCATCACGACTCGTTTCTGTCTTTCTTTCTCATCAAGAAATAATCCTACGCGACATCATATCTGCTCTAATTCGATGTCATCTCCTGGAGAATTTTACAATTCACTCCCTCCTGTAACCAAGGCTTATGCTACCTTGTGTTTGGTGACTACAACACTAGCTACCTTGAAGCTATTGCCCATTTAT...

CDS

Download CDS FASTA

723 bp · TkA01G463030|TK1151|CDS

ATGTCATCTCCTGGAGAATTTTACAATTCACTCCCTCCTGTAACCAAGGCTTATGCTACCTTGTGTTTGGTGACTACAACACTAGCTACCTTGAAGCTATTGCCCATTTATTATATCGCATTGATCTATGAGCAAGTCTTCTTTCGCCTGCAGGTGTGGAGGCTGTTTACAAACTTCATCTTTCTTGGCCCTTTCTCTATAAATTTTGGAATCCGCCTCTTAATGATATTAAGATATGGAGTTCAATTAGAGAACGGACC...

Protein

Download Protein FASTA

240 aa · TkA01G463030|TK1151|PROTEIN

MSSPGEFYNSLPPVTKAYATLCLVTTTLATLKLLPIYYIALIYEQVFFRLQVWRLFTNFIFLGPFSINFGIRLLMILRYGVQLENGPFNRRTADFLWMMIFGSTALLLLAAIPFFESYFLGVSLVFMLLYVWSREFPNAKINMYGLIELKAFYMPWAMLALDVIFGSPIAPDLCGILAGHLYYFLTVLHPLGGGKNILQTPMWLRKMVAKYKIGAPVYTRIQPESDTSGVFRGRSYRVGG

Flanking Sequence Download

Sequence orientation and download details

Upstream/downstream are capped at 10000 bp per side. Negative-strand genes are reverse-complemented so the final FASTA follows transcriptional 5′→3′ orientation.

ID Mapping

Input ID	`TkA01G463030`
TK1151 ID	TkA01G463030
OH-1004 ID	LXL04_002477
Relationship / confidence	Rbh High Identity Coverage Synteny / Strict
Protein identity (%)	99.600
Protein coverage (%)	TK1151 100.000 / OH-1004 100.000 Coverage and evidence Coverage is the aligned span of the best-scoring HSP divided by representative protein length. A homolog match does not establish functional validation.
Source version	TK1151 / GWHBCHF00000000

Open Full ID Mapping

SNP / Indel variants and carrier samplesCRA009020 · TK1151

Expand to load variant records for this gene.

Basic Information and Functional Annotation

Gene ID TkA01G463030

Location Chr01:116037968-116041559 (-)

Description Similar to DER1: Derlin-1

Arabidopsis / Rice Reference Genes and Papers

Download references for this gene

Arabidopsis

Reference gene ID	Possible function	Papers / DOI
`At4g29330`	May be involved in the degradation process of specific misfolded endoplasmic reticulum (ER) luminal proteins.	No verified direct reference in this release

Rice

Reference gene ID	Possible function	Papers / DOI
`Os05g0187800`	May be involved in the degradation process of specific misfolded endoplasmic reticulum (ER) luminal proteins.	No verified direct reference in this release

Functional annotation source

View annotation sources

Functional annotation source: OH1004 · LXL04_002477 · GCA_047496595.1_OSU_TarKok_2.0. These OH1004 annotations are retrieved through ID mapping; the Arabidopsis/rice table below uses protein alignments from the query reference.

GO annotations (OH1004 source)

GO:0008284 positive regulation of cell population proliferation Biological Process

GO:0030307 positive regulation of cell growth Biological Process

GO:0030968 endoplasmic reticulum unfolded protein response Biological Process

GO:0030970 retrograde protein transport, ER to cytosol Biological Process

GO:0036503 ERAD pathway Biological Process

GO:1904153 negative regulation of retrograde protein transport, ER to cytosol Biological Process

GO:0005769 early endosome Cellular Component

GO:0005770 late endosome Cellular Component

GO:0005783 endoplasmic reticulum Cellular Component

GO:0005789 endoplasmic reticulum membrane Cellular Component

GO:0005886 plasma membrane Cellular Component

GO:0009507 chloroplast Cellular Component

KEGG gene cross-reference

ath:AT4G29330

mmu:116891

zma:100037763

zma:606470

These KEGG gene identifiers are linked through homologous proteins; they do not establish pathway function for this gene.

Open Annotation Module

Gene expression

View expression in different studies, tissues and treatments. Results are presented separately by study and measurement unit.

View expression for this gene

Data sources and gene correspondence

Expression data come from public transcriptome studies. Reference genomes, sample metadata and measurement units are shown with the results. Ambiguous cross-reference correspondences do not select an expression record automatically; missing values do not mean zero expression.

Subcellular Localization Top 5

Computational predictions or homology annotations below do not replace localization experiments.

Endoplasmic reticulum0.887

Rank 1 · TkA01G463030 · TK1151

Golgi apparatus0.097

Rank 2 · TkA01G463030 · TK1151

Cytoplasm0.064

Rank 3 · TkA01G463030 · TK1151

Nucleus0.059

Rank 4 · TkA01G463030 · TK1151

Cell membrane0.031

Rank 5 · TkA01G463030 · TK1151

LocPro · Direct prediction · Computational prediction, not experimental localization

Open Subcellular Module

Predicted Functional Domains

Domain results are from Pfam-A/HMMER; positions are amino-acid coordinates on the protein sequence.

PF04511DER111-201 aa

Gene ID	Domain ID	Domain Name	Start aa	End aa	E-value	Score
TkA01G463030	`PF04511`	DER1	11	201	1.2e-46	159.8

Arabidopsis / Rice Protein Homology

Only Arabidopsis and rice are shown. Swiss-Prot entries are reviewed; TrEMBL entries are supplementary sequence candidates. Similarity is not experimental validation.

Download current result

Protein	Organism	Description	Identity	Database	Confidence
`Q8VZU9`	Arabidopsis thaliana	sp\|Q8VZU9\|DERL1_ARATH Derlin-1	64.500%	Swiss-Prot	High
`Q06397`	Oryza sativa subsp. japonica	sp\|Q06397\|DERL1_ORYSJ Derlin-1	63.800%	Swiss-Prot	High

JBrowse

View in Genome Browser

Gene Card