TkA01G449580 | RubberDandelionOmics

Gene overview

TkA01G449580

Reference: TK1151 Chr: Chr01 Coordinates: 112636565-112638210 Strand: - Type: protein_coding

cDNA / CDS / Protein Sequences

Available sequence downloads CDS FASTA Protein FASTA cDNA FASTA

cDNA

1152 bp · TkA01G449580|TK1151|cDNA

TTGAATTTCATATTCGAGCCCTAACCAGTGACCACCTCCCTCTCTCTTACCTCGGATTTTGGACGATCAACGCGGAGCAGCCATGGTTTGGTTTCAATGCGAGGACTGTGGCGATAACCTCAAGAAGCCGAAGCTCGCCAATCACTTCAGAGCTTGCTCCGCTAACAAGTTATCATGCATCGATTGCGGGCAAATGTTTGGGCAACAGAGTGTACAAGGACACACGCAATGTATCACGGAAACGGAGAAATATGGTCCAA...

CDS

Download CDS FASTA

795 bp · TkA01G449580|TK1151|CDS

ATGGTTTGGTTTCAATGCGAGGACTGTGGCGATAACCTCAAGAAGCCGAAGCTCGCCAATCACTTCAGAGCTTGCTCCGCTAACAAGTTATCATGCATCGATTGCGGGCAAATGTTTGGGCAACAGAGTGTACAAGGACACACGCAATGTATCACGGAAACGGAGAAATATGGTCCAAAGGGTCAAGCGAAACCTGCACAAGGTACACCTGGAAAACTCTCAAAGCCAAAACCAGAAGTCGATATTAATGTCGGATTATC...

Protein

Download Protein FASTA

264 aa · TkA01G449580|TK1151|PROTEIN

MVWFQCEDCGDNLKKPKLANHFRACSANKLSCIDCGQMFGQQSVQGHTQCITETEKYGPKGQAKPAQGTPGKLSKPKPEVDINVGLSERPPWFCSLCNTSATSKQTLLSHADGKKHRAKARAFHASKQPPKDSEEKPTPEVVEETQTSESKKRKLEDVEKNGELGNGEVIHDGNVESEKPKKVKCKKEDGEKSIKWKKIITAALKSNPDGNMKMRKLRSQVLKTLKESGSTVDENELADTLEHKINSSSKFAVNGKYVQL...

Flanking Sequence Download

Sequence orientation and download details

Upstream/downstream are capped at 10000 bp per side. Negative-strand genes are reverse-complemented so the final FASTA follows transcriptional 5′→3′ orientation.

ID Mapping

Input ID	`TkA01G449580`
TK1151 ID	TkA01G449580
OH-1004 ID	LXL04_002376
Relationship / confidence	Rbh High Identity Coverage Synteny / Strict
Protein identity (%)	99.600
Protein coverage (%)	TK1151 100.000 / OH-1004 100.000 Coverage and evidence Coverage is the aligned span of the best-scoring HSP divided by representative protein length. A homolog match does not establish functional validation.
Source version	TK1151 / GWHBCHF00000000

Open Full ID Mapping

SNP / Indel variants and carrier samplesCRA009020 · TK1151

Expand to load variant records for this gene.

Basic Information and Functional Annotation

Gene ID TkA01G449580

Location Chr01:112636565-112638210 (-)

Description Similar to UBA1C: UBP1-associated proteins 1C

Arabidopsis / Rice Reference Genes and Papers

Download references for this gene

Arabidopsis

Reference gene ID	Possible function	Papers / DOI
`At2g19380`	May regulate the turnover of mRNAs in the nucleus.	No verified direct reference in this release

Rice

No hit for this species in the current source table.

Functional annotation source

View annotation sources

Functional annotation source: OH1004 · LXL04_002376 · GCA_047496595.1_OSU_TarKok_2.0. These OH1004 annotations are retrieved through ID mapping; the Arabidopsis/rice table below uses protein alignments from the query reference.

GO annotations (OH1004 source)

GO:0000122 negative regulation of transcription by RNA polymerase II Biological Process

GO:0006351 DNA-templated transcription Biological Process

GO:0006364 rRNA processing Biological Process

GO:0045087 innate immune response Biological Process

GO:0045824 negative regulation of innate immune response Biological Process

GO:0045943 positive regulation of transcription by RNA polymerase I Biological Process

GO:0050766 positive regulation of phagocytosis Biological Process

GO:0005634 nucleus Cellular Component

GO:0005654 nucleoplasm Cellular Component

GO:0005730 nucleolus Cellular Component

GO:0005737 cytoplasm Cellular Component

GO:0003677 DNA binding Molecular Function

KEGG gene cross-reference

ath:AT2G19380

cel:CELE_C16C10.8

hsa:55646

spo:2540743

These KEGG gene identifiers are linked through homologous proteins; they do not establish pathway function for this gene.

Open Annotation Module

Gene expression

View expression in different studies, tissues and treatments. Results are presented separately by study and measurement unit.

View expression for this gene

Data sources and gene correspondence

Expression data come from public transcriptome studies. Reference genomes, sample metadata and measurement units are shown with the results. Ambiguous cross-reference correspondences do not select an expression record automatically; missing values do not mean zero expression.

Subcellular Localization Top 5

Computational predictions or homology annotations below do not replace localization experiments.

Nucleus0.863

Rank 1 · TkA01G449580 · TK1151

Cytoplasm0.231

Rank 2 · TkA01G449580 · TK1151

Mitochondrion0.036

Rank 3 · TkA01G449580 · TK1151

Cell membrane0.028

Rank 4 · TkA01G449580 · TK1151

Endoplasmic reticulum0.021

Rank 5 · TkA01G449580 · TK1151

LocPro · Direct prediction · Computational prediction, not experimental localization

Open Subcellular Module

Predicted Functional Domains

Domain results are from Pfam-A/HMMER; positions are amino-acid coordinates on the protein sequence.

PF23447DUF71281-15 aa

PF17848Zn_ribbon_ACC3-23 aa

PF08790zf-LYAR4-21 aa

PF12874zf-met4-9 aa

PF13894zf-C2H2_44-24 aa

PF18439zf_UBZ4-21 aa

PF00096zf-C2H24-10 aa

PF24292DUF74795-39 aa

Gene ID	Domain ID	Domain Name	Start aa	End aa	E-value	Score
TkA01G449580	`PF23447`	DUF7128	1	15	1.6	9.4
TkA01G449580	`PF17848`	Zn_ribbon_ACC	3	23	0.048	14.6
TkA01G449580	`PF08790`	zf-LYAR	4	21	3.1e-14	53.3
TkA01G449580	`PF12874`	zf-met	4	9	1.9e-07	31.9
TkA01G449580	`PF13894`	zf-C2H2_4	4	24	0.0059	17.9
TkA01G449580	`PF18439`	zf_UBZ	4	21	0.1	13.0
TkA01G449580	`PF00096`	zf-C2H2	4	10	0.59	11.4
TkA01G449580	`PF24292`	DUF7479	5	39	0.41	11.5
TkA01G449580	`PF28088`	HVO_2901	5	13	1.0	10.1
TkA01G449580	`PF01286`	XPA_N	6	23	0.15	12.8
TkA01G449580	`PF01258`	zf-dskA_traR	6	12	0.21	12.3
TkA01G449580	`PF12756`	zf-C2H2_2	14	48	0.06	14.3
TkA01G449580	`PF28088`	HVO_2901	17	40	1.0	10.1
TkA01G449580	`PF03251`	Tymo_45kd_70kd	20	130	0.013	15.2
TkA01G449580	`PF08790`	zf-LYAR	30	57	3.1e-14	53.3
TkA01G449580	`PF18439`	zf_UBZ	30	47	0.1	13.0

Arabidopsis / Rice Protein Homology

Only Arabidopsis and rice are shown. Swiss-Prot entries are reviewed; TrEMBL entries are supplementary sequence candidates. Similarity is not experimental validation.

Download current result

Protein	Organism	Description	Identity	Database	Confidence
`O64571`	Arabidopsis thaliana	sp\|O64571\|UBA1C_ARATH UBP1-associated proteins 1C	41.600%	Swiss-Prot	Low

JBrowse

View in Genome Browser

Gene Card