Gene Card
Gene overview
cDNA / CDS / Protein Sequences
1817 bp · TkA01G443870|TK1151|cDNA
GGGACAGAAGAGGAAGCGTCATCGCGACTGCAAACAAACGTGTCACGAACACCTAAGATAGAAGTCATCCGCTCACGGGCTTTCTACGAATTAAGAAGCAAAATCCGTTGTTTGCCGCGAACTGATTTAAGCTTATTATATCAAATTCAAGACTCAGATAGGTACATGTAGCAATACCATGGCTACAATGGAACAAAAAGCTCCACGTTCTTCATACCCAACTGCTGACATAGACAACAACAACAATTACTTCATCGACG...
1437 bp · TkA01G443870|TK1151|CDS
ATGGCTACAATGGAACAAAAAGCTCCACGTTCTTCATACCCAACTGCTGACATAGACAACAACAACAATTACTTCATCGACGACTACACCGATTCCACATGGTCCACTCCAAATGACCAAACTACCCTCCACCAACCCACATGGTCCGTTCCAAAAGACCAAACTACCCTCGAGTCCGAAGATTTTCTCGATGAAGATTACTACCAATCCGGTGACGAATACCCCAACTCCATACCCCACCCCACCACCCCTGAAGTCAA...
Protein
Download Protein FASTA478 aa · TkA01G443870|TK1151|PROTEIN
MATMEQKAPRSSYPTADIDNNNNYFIDDYTDSTWSTPNDQTTLHQPTWSVPKDQTTLESEDFLDEDYYQSGDEYPNSIPHPTTPEVNLKNVLTGIVAIVTGRNKDPTTAPENPPVSNVAFMGSSKNGDTYIHPSVYIPSAPPLLEPTGINYSAYKEVLESEPPDWLRDSSASACMQCNSPFTAITRGRHHCRFCGGIFCRTCSKGRCLLPVKFRERNPQRVCDTCYDMLDPLQGVLINTISNAVQVAKHDVMDWTCTRGW...
Flanking Sequence Download
Sequence orientation and download details
Upstream/downstream are capped at 10000 bp per side. Negative-strand genes are reverse-complemented so the final FASTA follows transcriptional 5′→3′ orientation.
ID Mapping
| Input ID | TkA01G443870 |
|---|---|
| TK1151 ID | TkA01G443870 |
| OH-1004 ID | LXL04_016650 |
| Relationship / confidence | Non Reciprocal Best Hit / Complex relationship |
| Protein identity (%) | 60.700 |
| Protein coverage (%) | TK1151 69.247 / OH-1004 63.532Coverage and evidenceCoverage is the aligned span of the best-scoring HSP divided by representative protein length. A homolog match does not establish functional validation. |
| Source version | TK1151 / GWHBCHF00000000 |
SNP / Indel variants and carrier samplesCRA009020 · TK1151
Expand to load variant records for this gene.
Basic Information and Functional Annotation
| Gene ID | TkA01G443870 |
|---|---|
| Location | Chr01:111090631-111093954 (-) |
| Description | Similar to SPAPJ696.02: SH3 domain-containing protein PJ696.02 (Schizosaccharomyces pombe (strain 972 / ATCC 24843) |
| Arabidopsis / Rice Reference Genes and Papers |
Download references for this gene ArabidopsisNo hit for this species in the current source table. RiceNo hit for this species in the current source table. |
| Functional annotation source | View annotation sourcesFunctional annotation source: OH1004 · |
| GO annotations (OH1004 source) | GO:0006897 endocytosis Biological Process GO:0030036 actin cytoskeleton organization Biological Process GO:0051017 actin filament bundle assembly Biological Process GO:0051666 actin cortical patch localization Biological Process GO:1900027 regulation of ruffle assembly Biological Process GO:0005829 cytosol Cellular Component GO:0032587 ruffle membrane Cellular Component GO:0019902 phosphatase binding Molecular Function GO:0035091 phosphatidylinositol binding Molecular Function GO:0051015 actin filament binding Molecular Function |
| KEGG gene cross-reference | hsa:26751 pon:100171917 sce:YHR016C spo:2543305 xla:446367 These KEGG gene identifiers are linked through homologous proteins; they do not establish pathway function for this gene. |
Gene expression
View expression in different studies, tissues and treatments. Results are presented separately by study and measurement unit.
Data sources and gene correspondence
Expression data come from public transcriptome studies. Reference genomes, sample metadata and measurement units are shown with the results. Ambiguous cross-reference correspondences do not select an expression record automatically; missing values do not mean zero expression.
Subcellular Localization Top 5
Computational predictions or homology annotations below do not replace localization experiments.
LocPro · Direct prediction · Computational prediction, not experimental localization
Predicted Functional Domains
Domain results are from Pfam-A/HMMER; positions are amino-acid coordinates on the protein sequence.
PF01363FYVE165-229 aaPF02318FYVE_2170-226 aaPF04366Ysc84346-471 aa| Gene ID | Domain ID | Domain Name | Start aa | End aa | E-value | Score |
|---|---|---|---|---|---|---|
| TkA01G443870 | PF01363 | FYVE | 165 | 229 | 2.3e-20 | 73.2 |
| TkA01G443870 | PF02318 | FYVE_2 | 170 | 226 | 0.0085 | 17.0 |
| TkA01G443870 | PF04366 | Ysc84 | 346 | 471 | 5.4e-38 | 130.3 |
Arabidopsis / Rice Protein Homology
Only Arabidopsis and rice are shown. Swiss-Prot entries are reviewed; TrEMBL entries are supplementary sequence candidates. Similarity is not experimental validation.
No result was found for this query.