TkA01G440920 | RubberDandelionOmics

Gene overview

TkA01G440920

Reference: TK1151 Chr: Chr01 Coordinates: 110176308-110180319 Strand: - Type: protein_coding

cDNA / CDS / Protein Sequences

Available sequence downloads CDS FASTA Protein FASTA cDNA FASTA

cDNA

2890 bp · TkA01G440920|TK1151|cDNA

CAATAGTCGCTCAAAAGAGAAAAGAAAATGCAAAATGGTAACTATATACACTAAAATAAAGTAAAATGAAACAAATCCAGCAATAATTTGCAGATACATCGTCTGAACCAACTAACCTTCTCTCTCTCAGGTGGATATCCGGCGTAGTCAGCCACCGCCTTTGATAATTGATCCATCATCATCACGTAATTCTCTCCGTCGATGCCAATTCTTTTCCCTCATTCAATCACAGATTCAGATCTAAGCTTTTGATTCTATCA...

CDS

Download CDS FASTA

2262 bp · TkA01G440920|TK1151|CDS

ATGGCTTCCAAGATGTCGTCTCGGTCAAGAGGAGGCGCCTCTGTAAAAGCCAATTCCAGAGAAACCGGCCCCAAGCTCGAGGAGAATCTTAACATCTTCAAGTCCGATAAATTCGACGCCGATGCCTTTGTCAACTCCAAGTGTAATTCCTTGAACGAGAAGGAAATAAGACAATTATGCTCATATCTTTTGGATTTAAAGAAAGCTTCTGCAGAGGAAATGCGAAGGAGTGTATACGCTAATTATACTGCATTCATACG...

Protein

Download Protein FASTA

753 aa · TkA01G440920|TK1151|PROTEIN

MASKMSSRSRGGASVKANSRETGPKLEENLNIFKSDKFDADAFVNSKCNSLNEKEIRQLCSYLLDLKKASAEEMRRSVYANYTAFIRTSKEISDLEGELLSIRNLLSTQATIIHGLADGVHVDSLSITLPEGSGISPDLDRDPSDLETWLIELPDILDVLLAERRVEEALSTLDEGERIASEAKANNSLTPILLSSLQTAITECRQRLANQLSEAASQPTTRGSELRAAITALKKLGDGPHAHTLLLQAHYQRLQSTLQN...

Flanking Sequence Download

Sequence orientation and download details

Upstream/downstream are capped at 10000 bp per side. Negative-strand genes are reverse-complemented so the final FASTA follows transcriptional 5′→3′ orientation.

ID Mapping

Input ID	`TkA01G440920`
TK1151 ID	TkA01G440920
OH-1004 ID	LXL04_002235
Relationship / confidence	Rbh High Identity Coverage Synteny / Strict
Protein identity (%)	100.000
Protein coverage (%)	TK1151 100.000 / OH-1004 100.000 Coverage and evidence Coverage is the aligned span of the best-scoring HSP divided by representative protein length. A homolog match does not establish functional validation.
Source version	TK1151 / GWHBCHF00000000

Open Full ID Mapping

SNP / Indel variants and carrier samplesCRA009020 · TK1151

Expand to load variant records for this gene.

Basic Information and Functional Annotation

Gene ID TkA01G440920

Location Chr01:110176308-110180319 (-)

Description Similar to EXO84B: Exocyst complex component EXO84B

Arabidopsis / Rice Reference Genes and Papers

Download references for this gene

Arabidopsis

Reference gene ID	Possible function	Papers / DOI
`At5g49830`	Component of the exocyst complex involved in the docking of exocytic vesicles with fusion sites on the plasma membrane during regulated or polarized secretion.	The Arabidopsis exocyst complex is involved in cytokinesis and cell plate maturation.2010 · DOI: 10.1105/tpc.110.074351 A Framework for Lateral Membrane Trafficking and Polar Tethering of the PEN3 ATP-Binding Cassette Transporter.2016 · DOI: 10.1104/pp.16.01252
`At1g10385`	Component of the exocyst complex involved in the docking of exocytic vesicles with fusion sites on the plasma membrane during regulated or polarized secretion.	No verified direct reference in this release
`At1g10180`	Component of the exocyst complex involved in the docking of exocytic vesicles with fusion sites on the plasma membrane during regulated or polarized secretion.	No verified direct reference in this release

Rice

No hit for this species in the current source table.

Functional annotation source

View annotation sources

Functional annotation source: OH1004 · LXL04_002235 · GCA_047496595.1_OSU_TarKok_2.0. These OH1004 annotations are retrieved through ID mapping; the Arabidopsis/rice table below uses protein alignments from the query reference.

GO annotations (OH1004 source)

GO:0000281 mitotic cytokinesis Biological Process

GO:0006887 exocytosis Biological Process

GO:0006893 Golgi to plasma membrane transport Biological Process

GO:0006904 vesicle docking involved in exocytosis Biological Process

GO:0007032 endosome organization Biological Process

GO:0008104 intracellular protein localization Biological Process

GO:0015031 protein transport Biological Process

GO:0022617 extracellular matrix disassembly Biological Process

GO:0060321 acceptance of pollen Biological Process

GO:0090148 membrane fission Biological Process

GO:0090522 vesicle tethering involved in exocytosis Biological Process

GO:0000145 exocyst Cellular Component

KEGG gene cross-reference

ath:AT1G10180

ath:AT1G10385

ath:AT5G49830

ddi:DDB_G0279991

mmu:102058

These KEGG gene identifiers are linked through homologous proteins; they do not establish pathway function for this gene.

Open Annotation Module

Gene expression

View expression in different studies, tissues and treatments. Results are presented separately by study and measurement unit.

View expression for this gene

Data sources and gene correspondence

Expression data come from public transcriptome studies. Reference genomes, sample metadata and measurement units are shown with the results. Ambiguous cross-reference correspondences do not select an expression record automatically; missing values do not mean zero expression.

Subcellular Localization Top 5

Computational predictions or homology annotations below do not replace localization experiments.

Cytoplasm0.564

Rank 1 · TkA01G440920 · TK1151

Golgi apparatus0.232

Rank 2 · TkA01G440920 · TK1151

Cell membrane0.219

Rank 3 · TkA01G440920 · TK1151

Nucleus0.201

Rank 4 · TkA01G440920 · TK1151

Lysosome / Vacuole0.174

Rank 5 · TkA01G440920 · TK1151

LocPro · Direct prediction · Computational prediction, not experimental localization

Open Subcellular Module

Predicted Functional Domains

Domain results are from Pfam-A/HMMER; positions are amino-acid coordinates on the protein sequence.

PF18822CdvA19-98 aa

PF06148COG2_N32-101 aa

PF08700VPS51_Exo84_N33-110 aa

PF16528Exo84_C41-62 aa

PF16528Exo84_C149-357 aa

PF20529DUF6744196-263 aa

PF08700VPS51_Exo84_N247-261 aa

PF27696EXO84_helical392-549 aa

Gene ID	Domain ID	Domain Name	Start aa	End aa	E-value	Score
TkA01G440920	`PF18822`	CdvA	19	98	0.29	11.8
TkA01G440920	`PF06148`	COG2_N	32	101	0.00011	22.9
TkA01G440920	`PF08700`	VPS51_Exo84_N	33	110	9.6e-14	52.0
TkA01G440920	`PF16528`	Exo84_C	41	62	1.2e-21	78.2
TkA01G440920	`PF16528`	Exo84_C	149	357	1.2e-21	78.2
TkA01G440920	`PF20529`	DUF6744	196	263	0.089	12.9
TkA01G440920	`PF08700`	VPS51_Exo84_N	247	261	9.6e-14	52.0
TkA01G440920	`PF27696`	EXO84_helical	392	549	1e-55	188.8
TkA01G440920	`PF18822`	CdvA	533	582	0.29	11.8

Arabidopsis / Rice Protein Homology

Only Arabidopsis and rice are shown. Swiss-Prot entries are reviewed; TrEMBL entries are supplementary sequence candidates. Similarity is not experimental validation.

Download current result

Protein	Organism	Description	Identity	Database	Confidence
`Q9LTB0`	Arabidopsis thaliana	sp\|Q9LTB0\|EX84B_ARATH Exocyst complex component EXO84B	70.600%	Swiss-Prot	High
`F4I4B6`	Arabidopsis thaliana	sp\|F4I4B6\|EX84A_ARATH Exocyst complex component EXO84A	60.800%	Swiss-Prot	High
`Q9SY60`	Arabidopsis thaliana	sp\|Q9SY60\|EX84C_ARATH Exocyst complex component EXO84C	33.900%	Swiss-Prot	Medium

JBrowse

View in Genome Browser

Gene Card