TkA01G345970 | RubberDandelionOmics

Gene overview

TkA01G345970

Reference: TK1151 Chr: Chr01 Coordinates: 85969745-85975925 Strand: - Type: protein_coding

cDNA / CDS / Protein Sequences

Available sequence downloads CDS FASTA Protein FASTA cDNA FASTA

cDNA

2643 bp · TkA01G345970|TK1151|cDNA

CTTCGATCCAACTCAGTTTTAGTGGGAAGGCAACCTTGATTCATAGCAATTGATCTCTCCAATAAATGAATCCGAGAACAAGTTACTGCAAGCAGCAGATGCGATGATTATTAGGGCATTTTCGCGTTCTGCAAGTTGTACTGAAGTTTGTTAAAGAAGTCATGTAAGTCTGATATTGAGTTGTACGATTGAGATTATAATACAACATTGGATCAAGGAGTGATGGAGTCAAGAATGGATCAGTACGAGATGATGGAGCA...

CDS

Download CDS FASTA

1266 bp · TkA01G345970|TK1151|CDS

ATGGACATTTATGTCCTCAATAACGATGAGCAAGAGGCAGGCAAACCGAGACCCGATGAACCCAAGTCAAATTACGAAACTGCCCATGTGAAAAATACACGGATGGGTGTCAAAGATGGTAAATTTAGGGAACAGAGTTCGCCCATGAGAGGCGGGCGGTTAAAGACCGATACACCATCATCGGAAAAGAGCACCAAGAGAACTCCGGGATCTAATTCTGTTAAGCATCAGGTACCTAAACAAGAGGAACCGTCAGATAA...

Protein

Download Protein FASTA

421 aa · TkA01G345970|TK1151|PROTEIN

MDIYVLNNDEQEAGKPRPDEPKSNYETAHVKNTRMGVKDGKFREQSSPMRGGRLKTDTPSSEKSTKRTPGSNSVKHQVPKQEEPSDNLNPRIRTPPPPTLLRKPSFLGRIKHLPIDAPIPDPSTVAKNVQPTEPIQTPDRVPVTKTIHTPVRDTIHTNRRQKLDPPPLDPIPVTKNVEPIATFQTPAPMQHTNGHQNPLSKIIQESRVVVSDNKQTDSSFEEAASSASIQRFEPPSLPTPDSGVPSESNSDSTTALQIPT...

Flanking Sequence Download

Sequence orientation and download details

Upstream/downstream are capped at 10000 bp per side. Negative-strand genes are reverse-complemented so the final FASTA follows transcriptional 5′→3′ orientation.

ID Mapping

Input ID	`TkA01G345970`
TK1151 ID	TkA01G345970
OH-1004 ID	LXL04_003526
Relationship / confidence	Rbh Below Probable Coverage Or Synteny Threshold / Review
Protein identity (%)	74.600
Protein coverage (%)	TK1151 100.000 / OH-1004 56.460 Coverage and evidence Coverage is the aligned span of the best-scoring HSP divided by representative protein length. A homolog match does not establish functional validation.
Source version	TK1151 / GWHBCHF00000000

Open Full ID Mapping

SNP / Indel variants and carrier samplesCRA009020 · TK1151

Expand to load variant records for this gene.

Basic Information and Functional Annotation

Gene ID TkA01G345970

Location Chr01:85969745-85975925 (-)

Description Similar to NEK5: Serine/threonine-protein kinase Nek5

Arabidopsis / Rice Reference Genes and Papers

Download references for this gene

Arabidopsis

Reference gene ID	Possible function	Papers / DOI
`At3g44200`	Involved in epidermal-cell morphogenesis in hypocotyls and roots.	No verified direct reference in this release

Rice

Reference gene ID	Possible function	Papers / DOI
`Os01g0864700`	May be involved in plant development processes.	No verified direct reference in this release
`Os05g0440800`	May be involved in plant development processes.	No verified direct reference in this release
`Os07g0176600`	May be involved in plant development processes (Probable).	Cytoplasmic male sterility-related protein kinase, OsNek3, is regulated downstream of mitochondrial protein phosphatase 2C, DCW11.2009 · DOI: 10.1093/pcp/pcp026
`Os03g0636800`	May be involved in plant development processes.	No verified direct reference in this release

Functional annotation source

View annotation sources

Functional annotation source: OH1004 · LXL04_003526 · GCA_047496595.1_OSU_TarKok_2.0. These OH1004 annotations are retrieved through ID mapping; the Arabidopsis/rice table below uses protein alignments from the query reference.

GO annotations (OH1004 source)

GO:0007017 microtubule-based process Biological Process

GO:0043622 cortical microtubule organization Biological Process

GO:0090627 plant epidermal cell differentiation Biological Process

GO:0005886 plasma membrane Cellular Component

GO:0055028 cortical microtubule Cellular Component

GO:0004672 protein kinase activity Molecular Function

GO:0004674 protein serine/threonine kinase activity Molecular Function

GO:0005524 ATP binding Molecular Function

GO:0106310 protein serine kinase activity Molecular Function

KEGG gene cross-reference

ath:AT3G44200

dosa:Os01g0864700

dosa:Os05g0440800

osa:4324792

osa:4338922

These KEGG gene identifiers are linked through homologous proteins; they do not establish pathway function for this gene.

Open Annotation Module

Gene expression

View expression in different studies, tissues and treatments. Results are presented separately by study and measurement unit.

View expression for this gene

Data sources and gene correspondence

Expression data come from public transcriptome studies. Reference genomes, sample metadata and measurement units are shown with the results. Ambiguous cross-reference correspondences do not select an expression record automatically; missing values do not mean zero expression.

Subcellular Localization Top 5

Computational predictions or homology annotations below do not replace localization experiments.

Cytoplasm0.419

Rank 1 · TkA01G345970 · TK1151

Nucleus0.327

Rank 2 · TkA01G345970 · TK1151

Cell membrane0.320

Rank 3 · TkA01G345970 · TK1151

Endoplasmic reticulum0.086

Rank 4 · TkA01G345970 · TK1151

Golgi apparatus0.062

Rank 5 · TkA01G345970 · TK1151

LocPro · Direct prediction · Computational prediction, not experimental localization

Open Subcellular Module

Predicted Functional Domains

No result was found for this query.

Arabidopsis / Rice Protein Homology

Only Arabidopsis and rice are shown. Swiss-Prot entries are reviewed; TrEMBL entries are supplementary sequence candidates. Similarity is not experimental validation.

Download current result

Protein	Organism	Description	Identity	Database	Confidence
`Q0WPH8`	Arabidopsis thaliana	sp\|Q0WPH8\|NEK5_ARATH Serine/threonine-protein kinase Nek5	83.300%	Swiss-Prot	Low
`Q94CU5`	Oryza sativa subsp. japonica	sp\|Q94CU5\|NEK5_ORYSJ Serine/threonine-protein kinase Nek5	79.500%	Swiss-Prot	Low
`Q60DG4`	Oryza sativa subsp. japonica	sp\|Q60DG4\|NEK4_ORYSJ Serine/threonine-protein kinase Nek4	75.000%	Swiss-Prot	Low
`Q6ZEZ5`	Oryza sativa subsp. japonica	sp\|Q6ZEZ5\|NEK3_ORYSJ Serine/threonine-protein kinase Nek3	72.400%	Swiss-Prot	Low
`Q10GB1`	Oryza sativa subsp. japonica	sp\|Q10GB1\|NEK1_ORYSJ Serine/threonine-protein kinase Nek1	71.900%	Swiss-Prot	Low

JBrowse

View in Genome Browser

Gene Card