TkA01G204660 | RubberDandelionOmics

Gene overview

TkA01G204660

Reference: TK1151 Chr: Chr01 Coordinates: 52112909-52113292 Strand: + Type: protein_coding

cDNA / CDS / Protein Sequences

Available sequence downloads CDS FASTA Protein FASTA cDNA FASTA

cDNA

384 bp · TkA01G204660|TK1151|cDNA

ATGTCTAGAAGCACGATCTTAACATTATATCTTCTGGTCTCTGTGTTATTCCTCTCGACTTTCGTGGCGAACGGAGGTCGGCCGGGAGGAAGGACGAAGGTAGCAGACGTGAAGACGAACAAGGAGGTTCAGGAACTCGGGAGGTACTCCGTGGAGGAGTACAATCGATCGGAACGAAGCCGGAAAGGTGGCGTCGGATCTCTGTCGTTCTCACAGGTGGTGTCGGCGGAGAAGCAGGTAGTGTCCGGGATCAAGTACTA...

CDS

Download CDS FASTA

384 bp · TkA01G204660|TK1151|CDS

ATGTCTAGAAGCACGATCTTAACATTATATCTTCTGGTCTCTGTGTTATTCCTCTCGACTTTCGTGGCGAACGGAGGTCGGCCGGGAGGAAGGACGAAGGTAGCAGACGTGAAGACGAACAAGGAGGTTCAGGAACTCGGGAGGTACTCCGTGGAGGAGTACAATCGATCGGAACGAAGCCGGAAAGGTGGCGTCGGATCTCTGTCGTTCTCACAGGTGGTGTCGGCGGAGAAGCAGGTAGTGTCCGGGATCAAGTACTA...

Protein

Download Protein FASTA

127 aa · TkA01G204660|TK1151|PROTEIN

MSRSTILTLYLLVSVLFLSTFVANGGRPGGRTKVADVKTNKEVQELGRYSVEEYNRSERSRKGGVGSLSFSQVVSAEKQVVSGIKYYLKIVAFSKSGISKVFEAEVVVKSWMHSKQLLNFKPSPANK

Flanking Sequence Download

Sequence orientation and download details

Upstream/downstream are capped at 10000 bp per side. Negative-strand genes are reverse-complemented so the final FASTA follows transcriptional 5′→3′ orientation.

ID Mapping

Input ID	`TkA01G204660`
TK1151 ID	TkA01G204660
OH-1004 ID	LXL04_004085
Relationship / confidence	Rbh Sequence Supported / Probable
Protein identity (%)	100.000
Protein coverage (%)	TK1151 99.213 / OH-1004 70.000 Coverage and evidence Coverage is the aligned span of the best-scoring HSP divided by representative protein length. A homolog match does not establish functional validation.
Source version	TK1151 / GWHBCHF00000000

Open Full ID Mapping

SNP / Indel variants and carrier samplesCRA009020 · TK1151

Expand to load variant records for this gene.

Basic Information and Functional Annotation

Gene ID TkA01G204660

Location Chr01:52112909-52113292 (+)

Description Similar to Cysteine proteinase inhibitor B

Arabidopsis / Rice Reference Genes and Papers

Download references for this gene

Arabidopsis

Reference gene ID	Possible function	Papers / DOI
`At2g31980`	Specific inhibitor of cysteine proteinases.	No verified direct reference in this release

Rice

Reference gene ID	Possible function	Papers / DOI
`Os01g0915200`	Specific inhibitor of cysteine proteinases.	No verified direct reference in this release
`UniProt: A2XS65`	Specific inhibitor of cysteine proteinases.	No verified direct reference in this release
`Os04g0350100`	Specific inhibitor of cysteine proteinases.	No verified direct reference in this release

Functional annotation source

View annotation sources

Functional annotation source: OH1004 · LXL04_004085 · GCA_047496595.1_OSU_TarKok_2.0. These OH1004 annotations are retrieved through ID mapping; the Arabidopsis/rice table below uses protein alignments from the query reference.

GO annotations (OH1004 source)

GO:0006952 defense response Biological Process

GO:0005576 extracellular region Cellular Component

GO:0004869 cysteine-type endopeptidase inhibitor activity Molecular Function

KEGG gene cross-reference

ath:AT2G31980

dosa:Os01g0915200

dosa:Os04g0350100

These KEGG gene identifiers are linked through homologous proteins; they do not establish pathway function for this gene.

Open Annotation Module

Gene expression

View expression in different studies, tissues and treatments. Results are presented separately by study and measurement unit.

View expression for this gene

Data sources and gene correspondence

Expression data come from public transcriptome studies. Reference genomes, sample metadata and measurement units are shown with the results. Ambiguous cross-reference correspondences do not select an expression record automatically; missing values do not mean zero expression.

Subcellular Localization Top 5

Computational predictions or homology annotations below do not replace localization experiments.

Extracellular0.451

Rank 1 · TkA01G204660 · TK1151

Endoplasmic reticulum0.195

Rank 2 · TkA01G204660 · TK1151

Cytoplasm0.174

Rank 3 · TkA01G204660 · TK1151

Lysosome / Vacuole0.162

Rank 4 · TkA01G204660 · TK1151

Cell membrane0.107

Rank 5 · TkA01G204660 · TK1151

LocPro · Direct prediction · Computational prediction, not experimental localization

Open Subcellular Module

Predicted Functional Domains

Domain results are from Pfam-A/HMMER; positions are amino-acid coordinates on the protein sequence.

PF00031Cystatin36-108 aa

PF16845SQAPI39-122 aa

Gene ID	Domain ID	Domain Name	Start aa	End aa	E-value	Score
TkA01G204660	`PF00031`	Cystatin	36	108	5.7e-07	30.4
TkA01G204660	`PF16845`	SQAPI	39	122	8.2e-17	62.1

Arabidopsis / Rice Protein Homology

Only Arabidopsis and rice are shown. Swiss-Prot entries are reviewed; TrEMBL entries are supplementary sequence candidates. Similarity is not experimental validation.

Download current result

Protein	Organism	Description	Identity	Database	Confidence
`Q8L5T9`	Arabidopsis thaliana	sp\|Q8L5T9\|CYT2_ARATH Cysteine proteinase inhibitor 2	44.800%	Swiss-Prot	Medium
`Q5N806`	Oryza sativa subsp. japonica	sp\|Q5N806\|CYT4_ORYSJ Cysteine proteinase inhibitor 4	52.400%	Swiss-Prot	High
`A2XS65`	Oryza sativa subsp. indica	sp\|A2XS65\|CYT10_ORYSI Cysteine proteinase inhibitor 10	46.500%	Swiss-Prot	Medium
`P0C579`	Oryza sativa subsp. japonica	sp\|P0C579\|CYT10_ORYSJ Cysteine proteinase inhibitor 10	46.500%	Swiss-Prot	Medium

JBrowse

View in Genome Browser

Gene Card