TkA01G133020 | RubberDandelionOmics

Gene overview

TkA01G133020

Reference: TK1151 Chr: Chr01 Coordinates: 33717606-33719759 Strand: - Type: protein_coding

cDNA / CDS / Protein Sequences

Available sequence downloads CDS FASTA Protein FASTA cDNA FASTA

cDNA

1342 bp · TkA01G133020|TK1151|cDNA

CGAACCTCTTTAAACTCGCTTTTTCGTCTTCCTCTTCGAATCAATTTCTCCTCTTTTGGTCCCTAATTGAAACTTTCTTCATTTTACCAAAAATCCCTATCTTCTATTCAAAATCTTGAAGAAAATCGCTGTAGGGTTTGTCCAGAATCTCTCTTTTGTTAACTTTAACATTTGGTTTAACATAAATCAGTTCCCCCTCAAATAAACCCAATTCGCGGTCTGACGTTCGATTTTTCGCGGTTCACTAGAGCGTTTCAAAG...

CDS

Download CDS FASTA

804 bp · TkA01G133020|TK1151|CDS

ATGAGAGGCGATAAAATGGCAAAAAGATCGTCTTTTGGGAAGACGATAAGAAAGAGGTTATCTGACATCACAAATTACCAGCCAAATCTCAAATCTGAACCTCTTTGTGATCAAATTCTGCCACCAGATAATTCACTGTATTCGGCTAAAAACCACATCGATCATCTCTTAAAGGAAAATGCAGAGCTCATGAAGCTTATCACAGACAAAAACAAAGTGATAGAGGTGAATGGAGCGGAGCTTCAGAAGCTACGAATTGT...

Protein

Download Protein FASTA

267 aa · TkA01G133020|TK1151|PROTEIN

MRGDKMAKRSSFGKTIRKRLSDITNYQPNLKSEPLCDQILPPDNSLYSAKNHIDHLLKENAELMKLITDKNKVIEVNGAELQKLRIVVQKTQLQNWNLAQSNSHMMAELNLGKQKLKTLQHQLTCKDALLKTMNQELQEHREINDRKGTSQVGDNPCTEQQNANKCTRPIRSQSHGPWMTTTDEQVSDKEKVENKRRCVRRQTARFRSQEKENLFEIEDIKMDENGQTSVDQKESQRMSFGRPSRRAAEKVQSYKETSLK...

Flanking Sequence Download

Sequence orientation and download details

Upstream/downstream are capped at 10000 bp per side. Negative-strand genes are reverse-complemented so the final FASTA follows transcriptional 5′→3′ orientation.

ID Mapping

Input ID	`TkA01G133020`
TK1151 ID	TkA01G133020
OH-1004 ID	LXL04_004568
Relationship / confidence	Rbh High Identity Coverage Synteny / Strict
Protein identity (%)	96.000
Protein coverage (%)	TK1151 100.000 / OH-1004 100.000 Coverage and evidence Coverage is the aligned span of the best-scoring HSP divided by representative protein length. A homolog match does not establish functional validation.
Source version	TK1151 / GWHBCHF00000000

Open Full ID Mapping

SNP / Indel variants and carrier samplesCRA009020 · TK1151

Expand to load variant records for this gene.

Basic Information and Functional Annotation

Gene ID TkA01G133020

Location Chr01:33717606-33719759 (-)

Description Similar to SGO2: SHUGOSHIN 2

Arabidopsis / Rice Reference Genes and Papers

Download references for this gene

Arabidopsis

Reference gene ID	Possible function	Papers / DOI
`At5g04320`	Dispensable for both meiotic and mitotic cell cycle progression.	SGO1 but not SGO2 is required for maintenance of centromere cohesion in Arabidopsis thaliana meiosis.2013 · DOI: 10.1007/s00497-013-0231-x Centromeric cohesion is protected twice at meiosis, by SHUGOSHINs at anaphase I and by PATRONUS at interkinesis.2013 · DOI: 10.1016/j.cub.2013.08.036 SHUGOSHINs and PATRONUS protect meiotic centromere cohesion in Arabidopsis thaliana.2014 · DOI: 10.1111/tpj.12432

Rice

No hit for this species in the current source table.

Functional annotation source

View annotation sources

Functional annotation source: OH1004 · LXL04_004568 · GCA_047496595.1_OSU_TarKok_2.0. These OH1004 annotations are retrieved through ID mapping; the Arabidopsis/rice table below uses protein alignments from the query reference.

GO annotations (OH1004 source)

GO:0034090 maintenance of meiotic sister chromatid cohesion Biological Process

GO:0045144 meiotic sister chromatid segregation Biological Process

GO:0051301 cell division Biological Process

GO:0000775 chromosome, centromeric region Cellular Component

GO:0005634 nucleus Cellular Component

GO:0005730 nucleolus Cellular Component

KEGG gene cross-reference

ath:AT5G04320

dosa:Os02g0799100

zma:606461

These KEGG gene identifiers are linked through homologous proteins; they do not establish pathway function for this gene.

Open Annotation Module

Gene expression

View expression in different studies, tissues and treatments. Results are presented separately by study and measurement unit.

View expression for this gene

Data sources and gene correspondence

Expression data come from public transcriptome studies. Reference genomes, sample metadata and measurement units are shown with the results. Ambiguous cross-reference correspondences do not select an expression record automatically; missing values do not mean zero expression.

Subcellular Localization Top 5

Computational predictions or homology annotations below do not replace localization experiments.

Nucleus0.939

Rank 1 · TkA01G133020 · TK1151

Cytoplasm0.171

Rank 2 · TkA01G133020 · TK1151

Cell membrane0.018

Rank 3 · TkA01G133020 · TK1151

Mitochondrion0.016

Rank 4 · TkA01G133020 · TK1151

Endoplasmic reticulum0.008

Rank 5 · TkA01G133020 · TK1151

LocPro · Direct prediction · Computational prediction, not experimental localization

Open Subcellular Module

Predicted Functional Domains

Domain results are from Pfam-A/HMMER; positions are amino-acid coordinates on the protein sequence.

PF28422CCDC8948-139 aa

PF21928XLF_CC56-74 aa

PF21928XLF_CC113-138 aa

PF28422CCDC89189-252 aa

PF07557Shugoshin_C196-201 aa

PF07557Shugoshin_C241-265 aa

Gene ID	Domain ID	Domain Name	Start aa	End aa	E-value	Score
TkA01G133020	`PF28422`	CCDC89	48	139	4.3	7.3
TkA01G133020	`PF21928`	XLF_CC	56	74	1.3	9.6
TkA01G133020	`PF21928`	XLF_CC	113	138	1.3	9.6
TkA01G133020	`PF28422`	CCDC89	189	252	4.3	7.3
TkA01G133020	`PF07557`	Shugoshin_C	196	201	6.6e-09	36.1
TkA01G133020	`PF07557`	Shugoshin_C	241	265	6.6e-09	36.1

Arabidopsis / Rice Protein Homology

Only Arabidopsis and rice are shown. Swiss-Prot entries are reviewed; TrEMBL entries are supplementary sequence candidates. Similarity is not experimental validation.

Download current result

Protein	Organism	Description	Identity	Database	Confidence
`Q0WTB8`	Arabidopsis thaliana	sp\|Q0WTB8\|SGO2_ARATH SHUGOSHIN 2	49.400%	Swiss-Prot	Low

JBrowse

View in Genome Browser

Gene Card