TkA01G096160 | RubberDandelionOmics

Gene overview

TkA01G096160

Reference: TK1151 Chr: Chr01 Coordinates: 24312196-24312851 Strand: + Type: protein_coding

cDNA / CDS / Protein Sequences

Available sequence downloads CDS FASTA Protein FASTA cDNA FASTA

cDNA

345 bp · TkA01G096160|TK1151|cDNA

ATGGCTTTAATACTGCTTGCATTACAAAGTTTTTTCCAACACGTTCACACACCGTTGCTGTTCAGGGATATAAATGCTGCTTTAGGAAATATGACGGAAGATGACTGGAGGTGGCACATGTATGACACAGTGAAGGGAAGCGATTGGTTAGCGCTTTGGAATAAATCTATAAGTGACCAAGATGCTATCCAGTATATGTGTAGAGAAGAACCAAAAGCAGTGATTGAGCATGAGAACTATGGACTACCGTTTTCTCGAAC...

CDS

Download CDS FASTA

345 bp · TkA01G096160|TK1151|CDS

ATGGCTTTAATACTGCTTGCATTACAAAGTTTTTTCCAACACGTTCACACACCGTTGCTGTTCAGGGATATAAATGCTGCTTTAGGAAATATGACGGAAGATGACTGGAGGTGGCACATGTATGACACAGTGAAGGGAAGCGATTGGTTAGCGCTTTGGAATAAATCTATAAGTGACCAAGATGCTATCCAGTATATGTGTAGAGAAGAACCAAAAGCAGTGATTGAGCATGAGAACTATGGACTACCGTTTTCTCGAAC...

Protein

Download Protein FASTA

114 aa · TkA01G096160|TK1151|PROTEIN

MALILLALQSFFQHVHTPLLFRDINAALGNMTEDDWRWHMYDTVKGSDWLALWNKSISDQDAIQYMCREEPKAVIEHENYGLPFSRTEEGRLIDVLVQLIKLDMHYCIHDMVKP

Flanking Sequence Download

Sequence orientation and download details

Upstream/downstream are capped at 10000 bp per side. Negative-strand genes are reverse-complemented so the final FASTA follows transcriptional 5′→3′ orientation.

ID Mapping

Input ID	`TkA01G096160`
TK1151 ID	TkA01G096160
OH-1004 ID	LXL04_004931
Relationship / confidence	Rbh Sequence Supported / Probable
Protein identity (%)	91.100
Protein coverage (%)	TK1151 100.000 / OH-1004 100.000 Coverage and evidence Coverage is the aligned span of the best-scoring HSP divided by representative protein length. A homolog match does not establish functional validation.
Source version	TK1151 / GWHBCHF00000000

Open Full ID Mapping

SNP / Indel variants and carrier samplesCRA009020 · TK1151

Expand to load variant records for this gene.

Basic Information and Functional Annotation

Gene ID TkA01G096160

Location Chr01:24312196-24312851 (+)

Description Similar to SDH1-1: Succinate dehydrogenase [ubiquinone] flavoprotein subunit 1, mitochondrial

Arabidopsis / Rice Reference Genes and Papers

Download references for this gene

Arabidopsis

Reference gene ID	Possible function	Papers / DOI
`At5g66760`	Flavoprotein (FP) subunit of succinate dehydrogenase (SDH) that is involved in complex II of the mitochondrial electron transport chain and is responsible for transferring electrons from succinate to ubiquinone (coenzyme Q).	No verified direct reference in this release
`At2g18450`	Flavoprotein (FP) subunit of succinate dehydrogenase (SDH) that is involved in complex II of the mitochondrial electron transport chain and is responsible for transferring electrons from succinate to ubiquinone (coenzyme Q).	No verified direct reference in this release

Rice

Reference gene ID	Possible function	Papers / DOI
`Os07g0134800`	Flavoprotein (FP) subunit of succinate dehydrogenase (SDH) that is involved in complex II of the mitochondrial electron transport chain and is responsible for transferring electrons from succinate to ubiquinone (coenzyme Q).	No verified direct reference in this release

Functional annotation source

View annotation sources

Functional annotation source: OH1004 · LXL04_004931 · GCA_047496595.1_OSU_TarKok_2.0. These OH1004 annotations are retrieved through ID mapping; the Arabidopsis/rice table below uses protein alignments from the query reference.

GO annotations (OH1004 source)

GO:0006099 tricarboxylic acid cycle Biological Process

GO:0006105 succinate metabolic process Biological Process

GO:0006121 mitochondrial electron transport, succinate to ubiquinone Biological Process

GO:0022900 electron transport chain Biological Process

GO:0022904 respiratory electron transport chain Biological Process

GO:0005739 mitochondrion Cellular Component

GO:0005743 mitochondrial inner membrane Cellular Component

GO:0005886 plasma membrane Cellular Component

GO:0009505 plant-type cell wall Cellular Component

GO:0009536 plastid Cellular Component

GO:0045273 respiratory chain complex II (succinate dehydrogenase) Cellular Component

GO:0000104 succinate dehydrogenase activity Molecular Function

KEGG gene cross-reference

ath:AT2G18450

ath:AT5G66760

dme:Dmel_CG17246

dosa:Os07g0134800

rco:RC0170

These KEGG gene identifiers are linked through homologous proteins; they do not establish pathway function for this gene.

Open Annotation Module

Gene expression

View expression in different studies, tissues and treatments. Results are presented separately by study and measurement unit.

View expression for this gene

Data sources and gene correspondence

Expression data come from public transcriptome studies. Reference genomes, sample metadata and measurement units are shown with the results. Ambiguous cross-reference correspondences do not select an expression record automatically; missing values do not mean zero expression.

Subcellular Localization Top 5

Computational predictions or homology annotations below do not replace localization experiments.

Extracellular0.300

Rank 1 · TkA01G096160 · TK1151

Cytoplasm0.255

Rank 2 · TkA01G096160 · TK1151

Nucleus0.206

Rank 3 · TkA01G096160 · TK1151

Mitochondrion0.165

Rank 4 · TkA01G096160 · TK1151

Endoplasmic reticulum0.097

Rank 5 · TkA01G096160 · TK1151

LocPro · Direct prediction · Computational prediction, not experimental localization

Open Subcellular Module

Predicted Functional Domains

Domain results are from Pfam-A/HMMER; positions are amino-acid coordinates on the protein sequence.

PF00890FAD_binding_225-94 aa

Gene ID	Domain ID	Domain Name	Start aa	End aa	E-value	Score
TkA01G096160	`PF00890`	FAD_binding_2	25	94	8.7e-09	35.8

Arabidopsis / Rice Protein Homology

Only Arabidopsis and rice are shown. Swiss-Prot entries are reviewed; TrEMBL entries are supplementary sequence candidates. Similarity is not experimental validation.

Download current result

Protein	Organism	Description	Identity	Database	Confidence
`O82663`	Arabidopsis thaliana	sp\|O82663\|SDHA1_ARATH Succinate dehydrogenase [ubiquinone] flavoprotein subunit 1, mitochondrial	75.300%	Swiss-Prot	Medium
`Q9ZPX5`	Arabidopsis thaliana	sp\|Q9ZPX5\|SDHA2_ARATH Succinate dehydrogenase [ubiquinone] flavoprotein subunit 2, mitochondrial	72.700%	Swiss-Prot	Medium
`Q6ZDY8`	Oryza sativa subsp. japonica	sp\|Q6ZDY8\|SDHA_ORYSJ Succinate dehydrogenase [ubiquinone] flavoprotein subunit, mitochondrial	74.000%	Swiss-Prot	Medium

JBrowse

View in Genome Browser

Gene Card