TkA01G068060 | RubberDandelionOmics

Gene overview

TkA01G068060

Reference: TK1151 Chr: Chr01 Coordinates: 17449437-17454165 Strand: - Type: protein_coding

cDNA / CDS / Protein Sequences

Available sequence downloads CDS FASTA Protein FASTA cDNA FASTA

cDNA

1365 bp · TkA01G068060|TK1151|cDNA

ATGAAGATGGTCTCCATGAAAAATGTATGCGCTCTTCTATTTCTAGGTGTTTTATGTTGCATTTCTTCGGTTACTCCAACCGGGAACATCTCTAGAGGAACTGCTGACGGTTCCGAAACATGGGGATACGTAGAAGTTCGTCCTGGGGCGCAAATGTTTTGGTGGTTATATGAAAGTCCTAATAAACCCAACCATACATCCAAACCATGGCCTACAATTCTATGGCTCCAAGGAGGCCCTGGAGAGTCCGGAGTTGCATA...

CDS

Download CDS FASTA

1365 bp · TkA01G068060|TK1151|CDS

ATGAAGATGGTCTCCATGAAAAATGTATGCGCTCTTCTATTTCTAGGTGTTTTATGTTGCATTTCTTCGGTTACTCCAACCGGGAACATCTCTAGAGGAACTGCTGACGGTTCCGAAACATGGGGATACGTAGAAGTTCGTCCTGGGGCGCAAATGTTTTGGTGGTTATATGAAAGTCCTAATAAACCCAACCATACATCCAAACCATGGCCTACAATTCTATGGCTCCAAGGAGGCCCTGGAGAGTCCGGAGTTGCATA...

Protein

Download Protein FASTA

454 aa · TkA01G068060|TK1151|PROTEIN

MKMVSMKNVCALLFLGVLCCISSVTPTGNISRGTADGSETWGYVEVRPGAQMFWWLYESPNKPNHTSKPWPTILWLQGGPGESGVAYGNFGEIGPLDADLKSRNSTWLQKADLLFVDSPVGVGFSYVEDRSLCAKTDLETTIDLMTLLKVIYDGNETTESRPFYIFGEHYGGKVALTLGLAILQATKTEELKLQLEGVALGNSWISPEDYVFSWGPLLKDVSRIDEVGLNQSNSLALKIQHQIAKEEYEYATDSFFSLLN...

Flanking Sequence Download

Sequence orientation and download details

Upstream/downstream are capped at 10000 bp per side. Negative-strand genes are reverse-complemented so the final FASTA follows transcriptional 5′→3′ orientation.

ID Mapping

Input ID	`TkA01G068060`
TK1151 ID	TkA01G068060
OH-1004 ID	LXL04_005299
Relationship / confidence	Rbh High Identity Coverage Synteny / Strict
Protein identity (%)	96.300
Protein coverage (%)	TK1151 100.000 / OH-1004 100.000 Coverage and evidence Coverage is the aligned span of the best-scoring HSP divided by representative protein length. A homolog match does not establish functional validation.
Source version	TK1151 / GWHBCHF00000000

Open Full ID Mapping

SNP / Indel variants and carrier samplesCRA009020 · TK1151

Expand to load variant records for this gene.

Basic Information and Functional Annotation

Gene ID TkA01G068060

Location Chr01:17449437-17454165 (-)

Description Similar to SCPL51: Serine carboxypeptidase-like 51

Arabidopsis / Rice Reference Genes and Papers

Download references for this gene

Arabidopsis

Reference gene ID	Possible function	Papers / DOI
`At2g27920`	Probable carboxypeptidase.	No verified direct reference in this release

Rice

No hit for this species in the current source table.

Functional annotation source

View annotation sources

Functional annotation source: OH1004 · LXL04_005299 · GCA_047496595.1_OSU_TarKok_2.0. These OH1004 annotations are retrieved through ID mapping; the Arabidopsis/rice table below uses protein alignments from the query reference.

GO annotations (OH1004 source)

GO:0006508 proteolysis Biological Process

GO:0042573 retinoic acid metabolic process Biological Process

GO:0045776 negative regulation of blood pressure Biological Process

GO:0097746 blood vessel diameter maintenance Biological Process

GO:0005576 extracellular region Cellular Component

GO:0048471 perinuclear region of cytoplasm Cellular Component

GO:0070062 extracellular exosome Cellular Component

GO:0004185 serine-type carboxypeptidase activity Molecular Function

KEGG gene cross-reference

ame:410451

ath:AT2G27920

hsa:59342

mmu:74617

rno:114861

These KEGG gene identifiers are linked through homologous proteins; they do not establish pathway function for this gene.

Open Annotation Module

Gene expression

View expression in different studies, tissues and treatments. Results are presented separately by study and measurement unit.

View expression for this gene

Data sources and gene correspondence

Expression data come from public transcriptome studies. Reference genomes, sample metadata and measurement units are shown with the results. Ambiguous cross-reference correspondences do not select an expression record automatically; missing values do not mean zero expression.

Subcellular Localization Top 5

Computational predictions or homology annotations below do not replace localization experiments.

Lysosome / Vacuole0.526

Rank 1 · TkA01G068060 · TK1151

Extracellular0.160

Rank 2 · TkA01G068060 · TK1151

Cytoplasm0.124

Rank 3 · TkA01G068060 · TK1151

Endoplasmic reticulum0.121

Rank 4 · TkA01G068060 · TK1151

Cell membrane0.087

Rank 5 · TkA01G068060 · TK1151

LocPro · Direct prediction · Computational prediction, not experimental localization

Open Subcellular Module

Predicted Functional Domains

Domain results are from Pfam-A/HMMER; positions are amino-acid coordinates on the protein sequence.

PF00450Peptidase_S1035-450 aa

Gene ID	Domain ID	Domain Name	Start aa	End aa	E-value	Score
TkA01G068060	`PF00450`	Peptidase_S10	35	450	3.2e-76	258.1

Arabidopsis / Rice Protein Homology

Only Arabidopsis and rice are shown. Swiss-Prot entries are reviewed; TrEMBL entries are supplementary sequence candidates. Similarity is not experimental validation.

Download current result

Protein	Organism	Description	Identity	Database	Confidence
`Q67Y83`	Arabidopsis thaliana	sp\|Q67Y83\|SCP51_ARATH Serine carboxypeptidase-like 51	52.500%	Swiss-Prot	High

JBrowse

View in Genome Browser

Gene Card