Gene Card
Gene overview
cDNA / CDS / Protein Sequences
2130 bp · TkA01G028930|TK1151|cDNA
ATCAGTCTTTGTAATTTTCCGTGGACGTTGCCTCACCACCGGCGCTGTAACTCGCCACCATTAGCGGCGCTGTTACTCACCTCCAGCAGCAGCAGCTCTGCTACTTCATCGACCACCGTGGTGTTTGATAAAAGTAGAACTATGCCTCCCCAACCAACCACCATACCCAAAAACTTAAACTTGTTCAATAGACATCGCAAACCCACCGCGGCCGATTTCGATCTTTCAAAATGGAATCCAGAGCAATCTATTATCTCCAC...
2130 bp · TkA01G028930|TK1151|CDS
ATCAGTCTTTGTAATTTTCCGTGGACGTTGCCTCACCACCGGCGCTGTAACTCGCCACCATTAGCGGCGCTGTTACTCACCTCCAGCAGCAGCAGCTCTGCTACTTCATCGACCACCGTGGTGTTTGATAAAAGTAGAACTATGCCTCCCCAACCAACCACCATACCCAAAAACTTAAACTTGTTCAATAGACATCGCAAACCCACCGCGGCCGATTTCGATCTTTCAAAATGGAATCCAGAGCAATCTATTATCTCCAC...
Protein
Download Protein FASTA709 aa · TkA01G028930|TK1151|PROTEIN
ISLCNFPWTLPHHRRCNSPPLAALLLTSSSSSSATSSTTVVFDKSRTMPPQPTTIPKNLNLFNRHRKPTAADFDLSKWNPEQSIISTSTPSPSQHYFSMAQTLSPIARYIVDSFRNHRWRWGPPVVADLNKLRRVTPKLVAEVLKVQTDPIISSKFFHWAGKQNGYKHDFATYNAFAYCLNRTNQFRAADQVPDLMNMQGKPPTEKQFEILIRMHSDANRGLRVYYVYEKMKKFGVKPRVFLYNRIMDTLVKTNHLDLSM...
Flanking Sequence Download
Sequence orientation and download details
Upstream/downstream are capped at 10000 bp per side. Negative-strand genes are reverse-complemented so the final FASTA follows transcriptional 5′→3′ orientation.
ID Mapping
| Input ID | TkA01G028930 |
|---|---|
| TK1151 ID | TkA01G028930 |
| OH-1004 ID | LXL04_005619 |
| Relationship / confidence | Rbh Sequence Supported / Probable |
| Protein identity (%) | 90.700 |
| Protein coverage (%) | TK1151 93.371 / OH-1004 100.000Coverage and evidenceCoverage is the aligned span of the best-scoring HSP divided by representative protein length. A homolog match does not establish functional validation. |
| Source version | TK1151 / GWHBCHF00000000 |
SNP / Indel variants and carrier samplesCRA009020 · TK1151
Expand to load variant records for this gene.
Basic Information and Functional Annotation
| Gene ID | TkA01G028930 | |||||||||
|---|---|---|---|---|---|---|---|---|---|---|
| Location | Chr01:7417690-7420120 (+) | |||||||||
| Description | Similar to At4g20740: Pentatricopeptide repeat-containing protein At4g20740 | |||||||||
| Arabidopsis / Rice Reference Genes and Papers |
Download references for this gene Arabidopsis
RiceNo hit for this species in the current source table. | |||||||||
| Functional annotation source | View annotation sourcesFunctional annotation source: OH1004 · | |||||||||
| GO annotations (OH1004 source) | GO:0009793 embryo development ending in seed dormancy Biological Process GO:0010239 chloroplast mRNA processing Biological Process GO:0009507 chloroplast Cellular Component GO:0042644 chloroplast nucleoid Cellular Component GO:0003729 mRNA binding Molecular Function | |||||||||
| KEGG gene cross-reference | ath:AT3G53700 ath:AT4G20740 These KEGG gene identifiers are linked through homologous proteins; they do not establish pathway function for this gene. |
Gene expression
View expression in different studies, tissues and treatments. Results are presented separately by study and measurement unit.
Data sources and gene correspondence
Expression data come from public transcriptome studies. Reference genomes, sample metadata and measurement units are shown with the results. Ambiguous cross-reference correspondences do not select an expression record automatically; missing values do not mean zero expression.
Subcellular Localization Top 5
Computational predictions or homology annotations below do not replace localization experiments.
LocPro · Direct prediction · Computational prediction, not experimental localization
Predicted Functional Domains
Domain results are from Pfam-A/HMMER; positions are amino-acid coordinates on the protein sequence.
PF13812PPR_3163-215 aaPF23276TPR_24163-266 aaPF12854PPR_1165-175 aaPF13424TPR_12166-189 aaPF13041PPR_2171-214 aaPF01535PPR172-190 aaPF13181TPR_8172-191 aaPF17177PPR_long187-304 aa| Gene ID | Domain ID | Domain Name | Start aa | End aa | E-value | Score |
|---|---|---|---|---|---|---|
| TkA01G028930 | PF13812 | PPR_3 | 163 | 215 | 2.3e-26 | 92.4 |
| TkA01G028930 | PF23276 | TPR_24 | 163 | 266 | 6.4e-21 | 75.4 |
| TkA01G028930 | PF12854 | PPR_1 | 165 | 175 | 4.7e-43 | 145.3 |
| TkA01G028930 | PF13424 | TPR_12 | 166 | 189 | 0.43 | 11.5 |
| TkA01G028930 | PF13041 | PPR_2 | 171 | 214 | 4.9e-60 | 200.2 |
| TkA01G028930 | PF01535 | PPR | 172 | 190 | 1.3e-41 | 138.7 |
| TkA01G028930 | PF13181 | TPR_8 | 172 | 191 | 0.29 | 12.1 |
| TkA01G028930 | PF17177 | PPR_long | 187 | 304 | 4.5e-22 | 79.2 |
| TkA01G028930 | PF13762 | MNE1 | 195 | 233 | 0.0038 | 17.9 |
| TkA01G028930 | PF29070 | MSC6_N | 196 | 299 | 1.2e-20 | 74.7 |
| TkA01G028930 | PF13041 | PPR_2 | 210 | 238 | 4.9e-60 | 200.2 |
| TkA01G028930 | PF01535 | PPR | 210 | 236 | 1.3e-41 | 138.7 |
| TkA01G028930 | PF13812 | PPR_3 | 223 | 252 | 2.3e-26 | 92.4 |
| TkA01G028930 | PF08579 | RPM2 | 223 | 253 | 4.0 | 8.6 |
| TkA01G028930 | PF13170 | DUF4003 | 226 | 243 | 0.12 | 12.6 |
| TkA01G028930 | PF12854 | PPR_1 | 235 | 250 | 4.7e-43 | 145.3 |
Arabidopsis / Rice Protein Homology
Only Arabidopsis and rice are shown. Swiss-Prot entries are reviewed; TrEMBL entries are supplementary sequence candidates. Similarity is not experimental validation.