TkA01G014080 | RubberDandelionOmics

Gene overview

TkA01G014080

Reference: TK1151 Chr: Chr01 Coordinates: 3655234-3658647 Strand: - Type: protein_coding

cDNA / CDS / Protein Sequences

Available sequence downloads CDS FASTA Protein FASTA cDNA FASTA

cDNA

3339 bp · TkA01G014080|TK1151|cDNA

TCATGTTATTTTCATAAATTTCTTCATCTTAATTAAATAATCTCATTCCCATCTTCATTACACTTAAATCTAAACTCCAGAAGATGACCAGAGCATGTGAAGACAACCATCTTTTTATAGGAAACAAACAAGATCACCACCATTAGAATATGCTTTAAAGTTTTTAAAGATCGTCACCATCGCCGCCACCGCATCACCACCATGGACCACCGATATTCTTTTCCGCCATTAAAACTCACGCCGATATCATTTACCTACCC...

CDS

Download CDS FASTA

2706 bp · TkA01G014080|TK1151|CDS

ATGTTTTTTTTGGTCTTTGAATCAATGAGAAGTTTATTGCCACAATGCTGCTACTTCACCGCGAGTTCGCTGTTGCTAATTGCATTCCTGTCGCCGGCGGCTGTCGATCAGGTGGCGGCAGCGGCGTCCGAGAAAGAGATCCTGCTTCAGTTCAAAGGTAACATAACAAGCGACCCTTACAATAGTTTGATTTCATGGAATTCTAGTACAGATCAGTGTAGAGATTATAGCGGTGTGTTTTGTGATTCTTTTGGGAATGT...

Protein

Download Protein FASTA

901 aa · TkA01G014080|TK1151|PROTEIN

MFFLVFESMRSLLPQCCYFTASSLLLIAFLSPAAVDQVAAAASEKEILLQFKGNITSDPYNSLISWNSSTDQCRDYSGVFCDSFGNVYKIVLWNTSLGGVLSPSLSELKSLRILTLFGNRFTGNIPPEFQELTTLWKINVSSNALSGSIPEFLGDLNSIRFLDLSRNGFEGSIPSSLFKVCEKTKFISLSHNNLSGALPIIVNNCLNLEGFDVSFNSLTGEFPSQICEIPPLSYLSVRNNMLTGTVHEQVSNCQRLELLD...

Flanking Sequence Download

Sequence orientation and download details

Upstream/downstream are capped at 10000 bp per side. Negative-strand genes are reverse-complemented so the final FASTA follows transcriptional 5′→3′ orientation.

ID Mapping

Input ID	`TkA01G014080`
TK1151 ID	TkA01G014080
OH-1004 ID	LXL04_005825
Relationship / confidence	Rbh High Identity Coverage Synteny / Strict
Protein identity (%)	99.900
Protein coverage (%)	TK1151 100.000 / OH-1004 84.363 Coverage and evidence Coverage is the aligned span of the best-scoring HSP divided by representative protein length. A homolog match does not establish functional validation.
Source version	TK1151 / GWHBCHF00000000

Open Full ID Mapping

SNP / Indel variants and carrier samplesCRA009020 · TK1151

Expand to load variant records for this gene.

Basic Information and Functional Annotation

Gene ID TkA01G014080

Location Chr01:3655234-3658647 (-)

Description Similar to At1g12460: Probable LRR receptor-like serine/threonine-protein kinase At1g12460

Arabidopsis / Rice Reference Genes and Papers

Download references for this gene

Arabidopsis

Reference gene ID	Possible function	Papers / DOI
`At1g12460`	Probable LRR receptor-like serine/threonine-protein kinase At1g12460.	No verified direct reference in this release
`At3g56370`	Probable LRR receptor-like serine/threonine-protein kinase IRK.	No verified direct reference in this release
`At3g28040`	Probably inactive leucine-rich repeat receptor-like protein kinase At3g28040.	No verified direct reference in this release
`At5g01890`	Leucine-rich repeat receptor-like protein kinase that may play a role in vascular tissues development.	No verified direct reference in this release
`At5g63930`	Probable leucine-rich repeat receptor-like protein kinase At5g63930.	No verified direct reference in this release

Rice

No hit for this species in the current source table.

Functional annotation source

View annotation sources

Functional annotation source: OH1004 · LXL04_005825 · GCA_047496595.1_OSU_TarKok_2.0. These OH1004 annotations are retrieved through ID mapping; the Arabidopsis/rice table below uses protein alignments from the query reference.

GO annotations (OH1004 source)

GO:0009553 embryo sac development Biological Process

GO:0010103 stomatal complex morphogenesis Biological Process

GO:0048364 root development Biological Process

GO:0048481 plant ovule development Biological Process

GO:0051302 regulation of cell division Biological Process

GO:0090511 periclinal cell division Biological Process

GO:0005886 plasma membrane Cellular Component

GO:0009507 chloroplast Cellular Component

GO:0016020 membrane Cellular Component

GO:0004672 protein kinase activity Molecular Function

GO:0004674 protein serine/threonine kinase activity Molecular Function

GO:0005524 ATP binding Molecular Function

KEGG gene cross-reference

ath:AT1G12460

ath:AT3G28040

ath:AT3G56370

ath:AT5G01890

ath:AT5G07180

These KEGG gene identifiers are linked through homologous proteins; they do not establish pathway function for this gene.

Open Annotation Module

Gene expression

View expression in different studies, tissues and treatments. Results are presented separately by study and measurement unit.

View expression for this gene

Data sources and gene correspondence

Expression data come from public transcriptome studies. Reference genomes, sample metadata and measurement units are shown with the results. Ambiguous cross-reference correspondences do not select an expression record automatically; missing values do not mean zero expression.

Subcellular Localization Top 5

Computational predictions or homology annotations below do not replace localization experiments.

Cell membrane0.864

Rank 1 · TkA01G014080 · TK1151

Endoplasmic reticulum0.094

Rank 2 · TkA01G014080 · TK1151

Cytoplasm0.057

Rank 3 · TkA01G014080 · TK1151

Nucleus0.042

Rank 4 · TkA01G014080 · TK1151

Lysosome / Vacuole0.027

Rank 5 · TkA01G014080 · TK1151

LocPro · Direct prediction · Computational prediction, not experimental localization

Open Subcellular Module

Predicted Functional Domains

Domain results are from Pfam-A/HMMER; positions are amino-acid coordinates on the protein sequence.

PF18303Saf_2TM15-52 aa

PF08263LRRNT_242-82 aa

PF13855LRR_886-145 aa

PF00560LRR_189-108 aa

PF12799LRR_491-121 aa

PF23598LRR_14101-165 aa

PF00560LRR_1110-132 aa

PF13855LRR_8110-168 aa

Gene ID	Domain ID	Domain Name	Start aa	End aa	E-value	Score
TkA01G014080	`PF18303`	Saf_2TM	15	52	0.024	15.0
TkA01G014080	`PF08263`	LRRNT_2	42	82	1.8e-07	32.0
TkA01G014080	`PF13855`	LRR_8	86	145	7.5e-24	84.0
TkA01G014080	`PF00560`	LRR_1	89	108	4.7e-33	106.8
TkA01G014080	`PF12799`	LRR_4	91	121	6.6e-17	61.9
TkA01G014080	`PF23598`	LRR_14	101	165	1.8e-17	63.9
TkA01G014080	`PF00560`	LRR_1	110	132	4.7e-33	106.8
TkA01G014080	`PF13855`	LRR_8	110	168	7.5e-24	84.0
TkA01G014080	`PF00560`	LRR_1	135	156	4.7e-33	106.8
TkA01G014080	`PF12799`	LRR_4	138	167	6.6e-17	61.9
TkA01G014080	`PF23211`	LRR_LRWD1	149	175	2.1	8.7
TkA01G014080	`PF00560`	LRR_1	158	178	4.7e-33	106.8
TkA01G014080	`PF13855`	LRR_8	172	215	7.5e-24	84.0
TkA01G014080	`PF00560`	LRR_1	185	205	4.7e-33	106.8
TkA01G014080	`PF23598`	LRR_14	185	261	1.8e-17	63.9
TkA01G014080	`PF12799`	LRR_4	186	218	6.6e-17	61.9

Arabidopsis / Rice Protein Homology

Only Arabidopsis and rice are shown. Swiss-Prot entries are reviewed; TrEMBL entries are supplementary sequence candidates. Similarity is not experimental validation.

Download current result

Protein	Organism	Description	Identity	Database	Confidence
`C0LGE4`	Arabidopsis thaliana	sp\|C0LGE4\|Y1124_ARATH Probable LRR receptor-like serine/threonine-protein kinase At1g12460	64.000%	Swiss-Prot	High
`Q9LY03`	Arabidopsis thaliana	sp\|Q9LY03\|IRK_ARATH Probable LRR receptor-like serine/threonine-protein kinase IRK	40.500%	Swiss-Prot	Low
`Q9LRT1`	Arabidopsis thaliana	sp\|Q9LRT1\|Y3804_ARATH Probably inactive leucine-rich repeat receptor-like protein kinase At3g28040	38.600%	Swiss-Prot	Low
`Q9LZV7`	Arabidopsis thaliana	sp\|Q9LZV7\|PXC2_ARATH Leucine-rich repeat receptor-like protein kinase PXC2	37.000%	Swiss-Prot	Low
`Q9LVP0`	Arabidopsis thaliana	sp\|Q9LVP0\|Y5639_ARATH Probable leucine-rich repeat receptor-like protein kinase At5g63930	34.800%	Swiss-Prot	Low

JBrowse

View in Genome Browser

Gene Card