Gene Card
Gene overview
cDNA / CDS / Protein Sequences
324 bp · TkA01G014020|TK1151|cDNA
ATGGATAACTGGGATGATATGAAGAAGATCTGGCATTACACCTTCTACAACGAGCTCCGTGTTGCTCCTGAAGAACACCCTATTCTTCTTACAGAAGCATCACTCAATCCAAAAGCCAATCGTGAGAAAGCGGTGGAGAAGAGCCACGAGTTACCCGACGGGCAGGTGATTACGATTGGGGCTGAGCGATTCAGGTATCCTGAAGTTCTCTTCCAGCCGTCATCTGCTAATGAAGCTTCATCAATGGTGTCTGATAGCAA...
324 bp · TkA01G014020|TK1151|CDS
ATGGATAACTGGGATGATATGAAGAAGATCTGGCATTACACCTTCTACAACGAGCTCCGTGTTGCTCCTGAAGAACACCCTATTCTTCTTACAGAAGCATCACTCAATCCAAAAGCCAATCGTGAGAAAGCGGTGGAGAAGAGCCACGAGTTACCCGACGGGCAGGTGATTACGATTGGGGCTGAGCGATTCAGGTATCCTGAAGTTCTCTTCCAGCCGTCATCTGCTAATGAAGCTTCATCAATGGTGTCTGATAGCAA...
Protein
Download Protein FASTA107 aa · TkA01G014020|TK1151|PROTEIN
MDNWDDMKKIWHYTFYNELRVAPEEHPILLTEASLNPKANREKAVEKSHELPDGQVITIGAERFRYPEVLFQPSSANEASSMVSDSKSYFSIDDEGNLNFRSQLILT
Flanking Sequence Download
Sequence orientation and download details
Upstream/downstream are capped at 10000 bp per side. Negative-strand genes are reverse-complemented so the final FASTA follows transcriptional 5′→3′ orientation.
ID Mapping
| Input ID | TkA01G014020 |
|---|---|
| TK1151 ID | TkA01G014020 |
| OH-1004 ID | LXL04_018488 |
| Relationship / confidence | Non Reciprocal Best Hit / Complex relationship |
| Protein identity (%) | 34.700 |
| Protein coverage (%) | TK1151 69.159 / OH-1004 50.000Coverage and evidenceCoverage is the aligned span of the best-scoring HSP divided by representative protein length. A homolog match does not establish functional validation. |
| Source version | TK1151 / GWHBCHF00000000 |
SNP / Indel variants and carrier samplesCRA009020 · TK1151
Expand to load variant records for this gene.
Basic Information and Functional Annotation
| Gene ID | TkA01G014020 | |||||||||
|---|---|---|---|---|---|---|---|---|---|---|
| Location | Chr01:3638063-3638386 (+) | |||||||||
| Description | Similar to Actin | |||||||||
| Arabidopsis / Rice Reference Genes and Papers |
Download references for this gene ArabidopsisNo hit for this species in the current source table. Rice
| |||||||||
| Functional annotation source | View annotation sourcesFunctional annotation source: OH1004 · | |||||||||
| GO annotations (OH1004 source) | GO:0048589 developmental growth Biological Process GO:0048767 root hair elongation Biological Process GO:0005634 nucleus Cellular Component GO:0005737 cytoplasm Cellular Component GO:0005783 endoplasmic reticulum Cellular Component GO:0005829 cytosol Cellular Component GO:0005886 plasma membrane Cellular Component GO:0009505 plant-type cell wall Cellular Component GO:0009506 plasmodesma Cellular Component GO:0015629 actin cytoskeleton Cellular Component GO:0005200 structural constituent of cytoskeleton Molecular Function GO:0005524 ATP binding Molecular Function | |||||||||
| KEGG gene cross-reference | ath:AT2G37620 ath:AT3G53750 dosa:Os03g0836000 ghi:107932458 ghi:107953109 These KEGG gene identifiers are linked through homologous proteins; they do not establish pathway function for this gene. |
Gene expression
View expression in different studies, tissues and treatments. Results are presented separately by study and measurement unit.
Data sources and gene correspondence
Expression data come from public transcriptome studies. Reference genomes, sample metadata and measurement units are shown with the results. Ambiguous cross-reference correspondences do not select an expression record automatically; missing values do not mean zero expression.
Subcellular Localization Top 5
Computational predictions or homology annotations below do not replace localization experiments.
LocPro · Direct prediction · Computational prediction, not experimental localization
Predicted Functional Domains
Domain results are from Pfam-A/HMMER; positions are amino-acid coordinates on the protein sequence.
PF00022Actin2-46 aaPF00022Actin46-85 aa| Gene ID | Domain ID | Domain Name | Start aa | End aa | E-value | Score |
|---|---|---|---|---|---|---|
| TkA01G014020 | PF00022 | Actin | 2 | 46 | 4.1e-24 | 85.7 |
| TkA01G014020 | PF00022 | Actin | 46 | 85 | 4.1e-24 | 85.7 |
Arabidopsis / Rice Protein Homology
Only Arabidopsis and rice are shown. Swiss-Prot entries are reviewed; TrEMBL entries are supplementary sequence candidates. Similarity is not experimental validation.