TkA01G010660 | RubberDandelionOmics

Gene overview

TkA01G010660

Reference: TK1151 Chr: Chr01 Coordinates: 2884166-2885718 Strand: + Type: protein_coding

cDNA / CDS / Protein Sequences

Available sequence downloads CDS FASTA Protein FASTA cDNA FASTA

cDNA

1305 bp · TkA01G010660|TK1151|cDNA

AAAATCTCCAACTATCCACAGCTATAAATGAACCCCTAATTGATAATCTCTTTCCTTTCTCTTCATCTTCCAATTTCTCTACCTGAAAACCCCCCAGTTTCCCCAAATCTCAATCAAATCCAGAAAGAAACCAATTTTACAACACCCATTAAACCTTCCAAAATTCTTTGAGGTTCTTGTTGTTCCTATGGGATCTGTTTTTTCTTCTTTTCTCGTTGTATGCAGCACACCCTCTGCTCCACCTGTTCCGCCGCCGGAAA...

CDS

Download CDS FASTA

852 bp · TkA01G010660|TK1151|CDS

ATGGGATCTGTTTTTTCTTCTTTTCTCGTTGTATGCAGCACACCCTCTGCTCCACCTGTTCCGCCGCCGGAAACTGCTCTCGGCGATCTGCCTGAGAGTGTGGTGGGTTCTCTTCTTGTACACCTAAACCCACAAGAAATCTGCAGGCTCGCTGTTCTTAATCGTGCGTTTCGTGGCGCTTCGTCGGCTGATTTCGTTTGGGAATCGAAATTGCCTGAGAATTATCATTCTCTTATATCGAGGGTATTTGATGATGGTAA...

Protein

Download Protein FASTA

283 aa · TkA01G010660|TK1151|PROTEIN

MGSVFSSFLVVCSTPSAPPVPPPETALGDLPESVVGSLLVHLNPQEICRLAVLNRAFRGASSADFVWESKLPENYHSLISRVFDDGNEFHSNLCKRDIYARLSRPNSIDGGTKKVWLHKGTGRPSLSISFNGLSITGIDDRRYWSRIPTDESRFKSVAYLQQIWWFEVDGEVDFPFPIGTYNLYFRLQLGRSGRRFGRRVCNCDEIHGWDKKPVRFQLSTSDGQKAMTECHLTSPGNWKFYHVGSFVVEDSKSPTKVKFS...

Flanking Sequence Download

Sequence orientation and download details

Upstream/downstream are capped at 10000 bp per side. Negative-strand genes are reverse-complemented so the final FASTA follows transcriptional 5′→3′ orientation.

ID Mapping

Input ID	`TkA01G010660`
TK1151 ID	TkA01G010660
OH-1004 ID	LXL04_029655
Relationship / confidence	Multi Source To Oh1004 / Complex relationship
Protein identity (%)	74.600
Protein coverage (%)	TK1151 100.000 / OH-1004 100.000 Coverage and evidence Coverage is the aligned span of the best-scoring HSP divided by representative protein length. A homolog match does not establish functional validation.
Source version	TK1151 / GWHBCHF00000000

Open Full ID Mapping

SNP / Indel variants and carrier samplesCRA009020 · TK1151

Expand to load variant records for this gene.

Basic Information and Functional Annotation

Gene ID TkA01G010660

Location Chr01:2884166-2885718 (+)

Description Similar to PP2A13: F-box protein PP2-A13

Arabidopsis / Rice Reference Genes and Papers

Download references for this gene

Arabidopsis

Reference gene ID	Possible function	Papers / DOI
`At1g12710`	F-box protein PP2-A12.	No verified direct reference in this release
`At1g63090`	Component of SCF(ASK-cullin-F-box) E3 ubiquitin ligase complexes, which may mediate the ubiquitination and subsequent proteasomal degradation of target proteins.	No verified direct reference in this release
`At3g61060`	Component of SCF(ASK-cullin-F-box) E3 ubiquitin ligase complexes, which may mediate the ubiquitination and subsequent proteasomal degradation of target proteins.	No verified direct reference in this release
`At5g52120`	Component of SCF(ASK-cullin-F-box) E3 ubiquitin ligase complexes, which may mediate the ubiquitination and subsequent proteasomal degradation of target proteins.	No verified direct reference in this release
`At3g53000`	F-box protein PP2-A15.	No verified direct reference in this release

Rice

No hit for this species in the current source table.

Functional annotation source

View annotation sources

Functional annotation source: OH1004 · LXL04_029655 · GCA_047496595.1_OSU_TarKok_2.0. These OH1004 annotations are retrieved through ID mapping; the Arabidopsis/rice table below uses protein alignments from the query reference.

GO annotations (OH1004 source)

GO:0009611 response to wounding Biological Process

GO:0016567 protein ubiquitination Biological Process

GO:0071456 cellular response to hypoxia Biological Process

GO:1900056 negative regulation of leaf senescence Biological Process

GO:0005634 nucleus Cellular Component

GO:0030246 carbohydrate binding Molecular Function

KEGG gene cross-reference

ath:AT1G12710

ath:AT1G63090

ath:AT3G53000

ath:AT3G61060

ath:AT5G52120

These KEGG gene identifiers are linked through homologous proteins; they do not establish pathway function for this gene.

Open Annotation Module

Gene expression

View expression in different studies, tissues and treatments. Results are presented separately by study and measurement unit.

View expression for this gene

Data sources and gene correspondence

Expression data come from public transcriptome studies. Reference genomes, sample metadata and measurement units are shown with the results. Ambiguous cross-reference correspondences do not select an expression record automatically; missing values do not mean zero expression.

Subcellular Localization Top 5

Computational predictions or homology annotations below do not replace localization experiments.

Nucleus0.560

Rank 1 · TkA01G010660 · TK1151

Cytoplasm0.464

Rank 2 · TkA01G010660 · TK1151

Cell membrane0.105

Rank 3 · TkA01G010660 · TK1151

Endoplasmic reticulum0.081

Rank 4 · TkA01G010660 · TK1151

Lysosome / Vacuole0.036

Rank 5 · TkA01G010660 · TK1151

LocPro · Direct prediction · Computational prediction, not experimental localization

Open Subcellular Module

Predicted Functional Domains

Domain results are from Pfam-A/HMMER; positions are amino-acid coordinates on the protein sequence.

PF12937F-box-like28-68 aa

PF00646F-box29-62 aa

PF14299PP2126-282 aa

Gene ID	Domain ID	Domain Name	Start aa	End aa	E-value	Score
TkA01G010660	`PF12937`	F-box-like	28	68	0.00046	20.6
TkA01G010660	`PF00646`	F-box	29	62	0.026	15.2
TkA01G010660	`PF14299`	PP2	126	282	7.4e-38	130.6

Arabidopsis / Rice Protein Homology

Only Arabidopsis and rice are shown. Swiss-Prot entries are reviewed; TrEMBL entries are supplementary sequence candidates. Similarity is not experimental validation.

Download current result

Protein	Organism	Description	Identity	Database	Confidence
`Q9LN77`	Arabidopsis thaliana	sp\|Q9LN77\|P2A12_ARATH F-box protein PP2-A12	65.100%	Swiss-Prot	High
`Q9CAN4`	Arabidopsis thaliana	sp\|Q9CAN4\|P2A11_ARATH F-box protein PP2-A11	62.100%	Swiss-Prot	High
`Q9LEX0`	Arabidopsis thaliana	sp\|Q9LEX0\|P2A13_ARATH F-box protein PP2-A13	61.600%	Swiss-Prot	High
`Q9FJ80`	Arabidopsis thaliana	sp\|Q9FJ80\|P2A14_ARATH F-box protein PP2-A14	51.400%	Swiss-Prot	High
`Q9LF92`	Arabidopsis thaliana	sp\|Q9LF92\|P2A15_ARATH F-box protein PP2-A15	56.200%	Swiss-Prot	High

JBrowse

View in Genome Browser

Gene Card