TkA01G005480 | RubberDandelionOmics

Gene overview

TkA01G005480

Reference: TK1151 Chr: Chr01 Coordinates: 1377519-1381847 Strand: - Type: protein_coding

cDNA / CDS / Protein Sequences

Available sequence downloads CDS FASTA Protein FASTA cDNA FASTA

cDNA

3371 bp · TkA01G005480|TK1151|cDNA

TTCCATGTTCTTAGTTATCTACGTGATCATTTCTATATATTGTTCCTCTAAACTTCTTTTTTTTGTCCAAGGTTATTGAAAGAAGTTGCCAATATTGTGCATGGTTATACACATGTGTCTCATAATATTGCCATAAAATTTTAGTACATTTTAAGCTTTGTAGAAGTGCATATGCTGGATGGTTGGAGGGTATTTTAGACTTTTTTCCCACAATTCATATTGCAAAGATAAAAACCAATAATATTGATGTGCCTCAACCG...

CDS

Download CDS FASTA

2022 bp · TkA01G005480|TK1151|CDS

ATGGCTTCGGAAGTCGCAAAGAAAAGGAAGGTGATCGGAATTGTTGTATTACTTGTGGTGGGAGCTATTGTAGGCACCATTGTCACCGTTAAAAGACACAAAGAAATCCAAATCAATGCACGAAAAGCGGGCGGCACGAAAACCGGTATTATTGCCGCCACGGCGGTGACCGCTGCCACTGCCACCGCAACGGTGATCTTTCTTTGCAAACACACGGATTTCAAAAAAGTTTGTGAGGAAACTTTGAGTAGAGTTGGTTT...

Protein

Download Protein FASTA

673 aa · TkA01G005480|TK1151|PROTEIN

MASEVAKKRKVIGIVVLLVVGAIVGTIVTVKRHKEIQINARKAGGTKTGIIAATAVTAATATATVIFLCKHTDFKKVCEETLSRVGLKEPRDMIKANFNAAMESILVAIEKSYTLKVAAKDPMAAKAIEQCNELLHVSIEDLKRSVDNVNVSNLRKLKQSVIDLRVWLSGAVTWQETCIDAFDNTTGDSKTKMWGLMENGNCLTRNSLAIVDGMAELSVDVKRPPRKLPQPKPISMPISVNWKADLTINPMAFRPDGGVN...

Flanking Sequence Download

Sequence orientation and download details

Upstream/downstream are capped at 10000 bp per side. Negative-strand genes are reverse-complemented so the final FASTA follows transcriptional 5′→3′ orientation.

ID Mapping

Input ID	`TkA01G005480`
TK1151 ID	TkA01G005480
OH-1004 ID	LXL04_005952
Relationship / confidence	Rbh High Identity Coverage Synteny / Strict
Protein identity (%)	99.100
Protein coverage (%)	TK1151 100.000 / OH-1004 100.000 Coverage and evidence Coverage is the aligned span of the best-scoring HSP divided by representative protein length. A homolog match does not establish functional validation.
Source version	TK1151 / GWHBCHF00000000

Open Full ID Mapping

SNP / Indel variants and carrier samplesCRA009020 · TK1151

Expand to load variant records for this gene.

Basic Information and Functional Annotation

Gene ID TkA01G005480

Location Chr01:1377519-1381847 (-)

Description Similar to PME28: Putative pectinesterase/pectinesterase inhibitor 28

Arabidopsis / Rice Reference Genes and Papers

Download references for this gene

Arabidopsis

Reference gene ID	Possible function	Papers / DOI
`At3g05610`	Acts in the modification of cell walls via demethylesterification of cell wall pectin.	No verified direct reference in this release
`At5g49180`	Acts in the modification of cell walls via demethylesterification of cell wall pectin.	No verified direct reference in this release
`At3g06830`	Acts in the modification of cell walls via demethylesterification of cell wall pectin.	No verified direct reference in this release
`At4g15980`	Acts in the modification of cell walls via demethylesterification of cell wall pectin.	No verified direct reference in this release
`At5g27870`	Acts in the modification of cell walls via demethylesterification of cell wall pectin.	No verified direct reference in this release

Rice

No hit for this species in the current source table.

Functional annotation source

View annotation sources

Functional annotation source: OH1004 · LXL04_005952 · GCA_047496595.1_OSU_TarKok_2.0. These OH1004 annotations are retrieved through ID mapping; the Arabidopsis/rice table below uses protein alignments from the query reference.

GO annotations (OH1004 source)

GO:0042545 cell wall modification Biological Process

GO:0045490 pectin catabolic process Biological Process

GO:0005634 nucleus Cellular Component

GO:0016020 membrane Cellular Component

GO:0030599 pectinesterase activity Molecular Function

GO:0046910 pectinesterase inhibitor activity Molecular Function

KEGG gene cross-reference

ath:AT3G05610

ath:AT5G27870

These KEGG gene identifiers are linked through homologous proteins; they do not establish pathway function for this gene.

Open Annotation Module

Gene expression

View expression in different studies, tissues and treatments. Results are presented separately by study and measurement unit.

View expression for this gene

Data sources and gene correspondence

Expression data come from public transcriptome studies. Reference genomes, sample metadata and measurement units are shown with the results. Ambiguous cross-reference correspondences do not select an expression record automatically; missing values do not mean zero expression.

Subcellular Localization Top 5

Computational predictions or homology annotations below do not replace localization experiments.

Cell membrane0.382

Rank 1 · TkA01G005480 · TK1151

Extracellular0.345

Rank 2 · TkA01G005480 · TK1151

Cytoplasm0.115

Rank 3 · TkA01G005480 · TK1151

Endoplasmic reticulum0.109

Rank 4 · TkA01G005480 · TK1151

Lysosome / Vacuole0.070

Rank 5 · TkA01G005480 · TK1151

LocPro · Direct prediction · Computational prediction, not experimental localization

Open Subcellular Module

Predicted Functional Domains

Domain results are from Pfam-A/HMMER; positions are amino-acid coordinates on the protein sequence.

PF14074DUF425714-70 aa

PF01095Pectinesterase39-55 aa

PF13888MRF_C258-118 aa

PF04043PMEI68-210 aa

PF01095Pectinesterase360-656 aa

PF13888MRF_C2469-502 aa

Gene ID	Domain ID	Domain Name	Start aa	End aa	E-value	Score
TkA01G005480	`PF14074`	DUF4257	14	70	0.24	12.2
TkA01G005480	`PF01095`	Pectinesterase	39	55	4.4e-135	449.9
TkA01G005480	`PF13888`	MRF_C2	58	118	0.46	11.2
TkA01G005480	`PF04043`	PMEI	68	210	8.8e-22	78.6
TkA01G005480	`PF01095`	Pectinesterase	360	656	4.4e-135	449.9
TkA01G005480	`PF13888`	MRF_C2	469	502	0.46	11.2

Arabidopsis / Rice Protein Homology

Only Arabidopsis and rice are shown. Swiss-Prot entries are reviewed; TrEMBL entries are supplementary sequence candidates. Similarity is not experimental validation.

Download current result

Protein	Organism	Description	Identity	Database	Confidence
`Q8GX86`	Arabidopsis thaliana	sp\|Q8GX86\|PME21_ARATH Probable pectinesterase/pectinesterase inhibitor 21	40.300%	Swiss-Prot	Medium
`Q9FJ21`	Arabidopsis thaliana	sp\|Q9FJ21\|PME58_ARATH Probable pectinesterase/pectinesterase inhibitor 58	39.700%	Swiss-Prot	Medium
`Q8GXA1`	Arabidopsis thaliana	sp\|Q8GXA1\|PME23_ARATH Probable pectinesterase/pectinesterase inhibitor 23	39.600%	Swiss-Prot	Medium
`O23447`	Arabidopsis thaliana	sp\|O23447\|PME43_ARATH Putative pectinesterase/pectinesterase inhibitor 43	39.300%	Swiss-Prot	Medium
`Q3E8Z8`	Arabidopsis thaliana	sp\|Q3E8Z8\|PME28_ARATH Putative pectinesterase/pectinesterase inhibitor 28	56.600%	Swiss-Prot	Medium

JBrowse

View in Genome Browser

Gene Card