RubberDandelionOmics Rubber Dandelion Multi-omics Website
More
Transcriptome Expression Annotation Rubber Pathway TF Prediction Targets Protein Network Resequencing Tools Downloads
ZH EN

How to use this page

Gene Card

Enter a TK1151 or OH-1004 gene ID to view sequences, annotations and analyses in the corresponding reference genome.
Flanking length, max 10000 bp
Examples TkA01G624900 LXL04_000258

Gene overview

TkA01G003760
Reference: TK1151 Chr: Chr01 Coordinates: 997858-1001049 Strand: + Type: protein_coding

cDNA / CDS / Protein Sequences

Available sequence downloads CDS FASTA Protein FASTA cDNA FASTA

cDNA

Download cDNA FASTA

2100 bp · TkA01G003760|TK1151|cDNA

GAAGCAACTCCAGTCTTAAAACTTTAAACCAAAGCATATACACATCCTTACCACACTTGGCCAATGGCCATGGCCCTCCACTCTGTGGTTCCAAATTCTGAAAACATCACCACCACCATCACCGCCGCTCCCGCTAATCAGGACCATGGCCATCAGCACACGGCCTTATACCCTATAACTCTAAAGTTTGAAGACGTCGTTTATAAAGTTAAACTTGAACAAAAAGGTTCAAGAGAGAAGACGATACTAAATGGGGTAAC...

CDS

Download CDS FASTA

1890 bp · TkA01G003760|TK1151|CDS

ATGGCCATGGCCCTCCACTCTGTGGTTCCAAATTCTGAAAACATCACCACCACCATCACCGCCGCTCCCGCTAATCAGGACCATGGCCATCAGCACACGGCCTTATACCCTATAACTCTAAAGTTTGAAGACGTCGTTTATAAAGTTAAACTTGAACAAAAAGGTTCAAGAGAGAAGACGATACTAAATGGGGTAACAGGTACGGTTTGTCCAGGAGAGATACTAGCAATGTTGGGTCCATCAGGAAGTGGTAAAACCAC...

Protein

Download Protein FASTA

629 aa · TkA01G003760|TK1151|PROTEIN

MAMALHSVVPNSENITTTITAAPANQDHGHQHTALYPITLKFEDVVYKVKLEQKGSREKTILNGVTGTVCPGEILAMLGPSGSGKTTLLTALGGRLTGKLSGKITYNSHPFSGPTKRKTGFVTQDDVLYPHLTVNETLLFTAMLRLPKTLTQVEKVHQVARVIAELGLTRCQNSMIGGPLFRGISGGEKKRVSIGQEMLINPSLLLLDEPTSGLDSTTAHRILTMVKRLASGGRTVVTTIHQPSSRIYHMFDKVILLSEG...

Flanking Sequence Download

Sequence orientation and download details

Upstream/downstream are capped at 10000 bp per side. Negative-strand genes are reverse-complemented so the final FASTA follows transcriptional 5′→3′ orientation.

Download Gene (CDS) Download Protein

ID Mapping

Input IDTkA01G003760
TK1151 IDTkA01G003760
OH-1004 IDLXL04_005969
Relationship / confidenceMulti Source To Oh1004 / Complex relationship
Protein identity (%)98.700
Protein coverage (%)TK1151 100.000 / OH-1004 100.000
Coverage and evidence

Coverage is the aligned span of the best-scoring HSP divided by representative protein length. A homolog match does not establish functional validation.

Source versionTK1151 / GWHBCHF00000000
Open Full ID Mapping
SNP / Indel variants and carrier samplesCRA009020 · TK1151

Expand to load variant records for this gene.

Basic Information and Functional Annotation

Gene IDTkA01G003760
LocationChr01:997858-1001049 (+)
DescriptionSimilar to ABCG14: ABC transporter G family member 14
Arabidopsis / Rice Reference Genes and Papers

Download references for this gene

Arabidopsis

Reference gene IDPossible functionPapers / DOI
At1g31770 Positive regulator of plant growth which acts as an efflux pump involved in the major root-to-shoot (acropetal) long-distance cytokinin (CK) transport via the xylem sap.
ABCG9, ABCG11 and ABCG14 ABC transporters are required for vascular development in Arabidopsis.2013 · DOI: 10.1111/tpj.12334
Arabidopsis ABCG14 protein controls the acropetal translocation of root-synthesized cytokinins.2014 · DOI: 10.1038/ncomms4274
Arabidopsis ABCG14 is essential for the root-to-shoot translocation of cytokinin.2014 · DOI: 10.1073/pnas.1321519111
Cytokinin Response Factor 6 Represses Cytokinin-Associated Genes during Oxidative Stress.2016 · DOI: 10.1104/pp.16.00415
A Role of Cytokinin Transporter in Arabidopsis Immunity.2017 · DOI: 10.1094/mpmi-01-17-0011-r
At3g25620 ABC transporter G family member 21. No verified direct reference in this release
At4g27420 Together with ABCG31, involved in pollen coat deposition of steryl glycosides required for pollen fitness.
ABCG9, ABCG11 and ABCG14 ABC transporters are required for vascular development in Arabidopsis.2013 · DOI: 10.1111/tpj.12334
The role of Arabidopsis ABCG9 and ABCG31 ATP binding cassette transporters in pollen fitness and the deposition of steryl glycosides on the pollen coat.2014 · DOI: 10.1105/tpc.113.118935
At5g06530 ABC transporter G family member 22. No verified direct reference in this release
At3g52310 ABC transporter G family member 27. No verified direct reference in this release

Rice

No hit for this species in the current source table.

Functional annotation source
View annotation sources

Functional annotation source: OH1004 · LXL04_005969 · GCA_047496595.1_OSU_TarKok_2.0. These OH1004 annotations are retrieved through ID mapping; the Arabidopsis/rice table below uses protein alignments from the query reference.

GO annotations (OH1004 source)
GO:0009414 response to water deprivation Biological Process
GO:0009736 cytokinin-activated signaling pathway Biological Process
GO:0010115 regulation of abscisic acid biosynthetic process Biological Process
GO:0010148 transpiration Biological Process
GO:0010184 cytokinin transport Biological Process
GO:0010208 pollen wall assembly Biological Process
GO:0010222 stem vascular tissue pattern formation Biological Process
GO:0010588 cotyledon vascular tissue pattern formation Biological Process
GO:0042542 response to hydrogen peroxide Biological Process
GO:0042742 defense response to bacterium Biological Process
GO:0055085 transmembrane transport Biological Process
GO:0140115 export across plasma membrane Biological Process
KEGG gene cross-reference
ath:AT1G31770
ath:AT3G25620
ath:AT4G27420
ath:AT5G06530
These KEGG gene identifiers are linked through homologous proteins; they do not establish pathway function for this gene.
Open Annotation Module

Gene expression

View expression in different studies, tissues and treatments. Results are presented separately by study and measurement unit.

View expression for this gene
Data sources and gene correspondence

Expression data come from public transcriptome studies. Reference genomes, sample metadata and measurement units are shown with the results. Ambiguous cross-reference correspondences do not select an expression record automatically; missing values do not mean zero expression.

Subcellular Localization Top 5

Computational predictions or homology annotations below do not replace localization experiments.

Cell membrane0.635
Rank 1 · TkA01G003760 · TK1151
Cytoplasm0.157
Rank 2 · TkA01G003760 · TK1151
Lysosome / Vacuole0.125
Rank 3 · TkA01G003760 · TK1151
Endoplasmic reticulum0.117
Rank 4 · TkA01G003760 · TK1151
Golgi apparatus0.075
Rank 5 · TkA01G003760 · TK1151

LocPro · Direct prediction · Computational prediction, not experimental localization

Open Subcellular Module

Predicted Functional Domains

Domain results are from Pfam-A/HMMER; positions are amino-acid coordinates on the protein sequence.

PF00005ABC_tran62-212 aa
PF09818ABC_ATPase64-92 aa
PF13481AAA_2567-97 aa
PF03193RsgA_GTPase72-97 aa
PF13191AAA_1673-107 aa
PF02463SMC_N74-92 aa
PF13555AAA_2974-108 aa
PF13401AAA_2274-98 aa
Gene IDDomain IDDomain NameStart aaEnd aaE-valueScore
TkA01G003760PF00005ABC_tran622126e-2795.6
TkA01G003760PF09818ABC_ATPase64920.211.3
TkA01G003760PF13481AAA_2567970.3411.2
TkA01G003760PF03193RsgA_GTPase72970.09713.2
TkA01G003760PF13191AAA_16731070.01616.4
TkA01G003760PF02463SMC_N74920.003417.6
TkA01G003760PF13555AAA_29741080.00417.6
TkA01G003760PF13401AAA_2274980.1712.9
TkA01G003760PF25199nSTAND_NTPase5741090.1912.3
TkA01G003760PF13304AAA_2175933.3e-0834.6
TkA01G003760PF13671AAA_3375960.1712.9
TkA01G003760PF13476AAA_23771040.004518.4
TkA01G003760PF02463SMC_N1842510.003417.6
TkA01G003760PF09818ABC_ATPase1852710.211.3
TkA01G003760PF13304AAA_212022393.3e-0834.6
TkA01G003760PF19055ABC2_membrane_72413001.7e-1454.3

Arabidopsis / Rice Protein Homology

Only Arabidopsis and rice are shown. Swiss-Prot entries are reviewed; TrEMBL entries are supplementary sequence candidates. Similarity is not experimental validation.

Download current result

ProteinOrganismDescriptionIdentityDatabaseConfidence
Q9C6W5Arabidopsis thalianasp|Q9C6W5|AB14G_ARATH ABC transporter G family member 1474.000%Swiss-ProtHigh
Q7XA72Arabidopsis thalianasp|Q7XA72|AB21G_ARATH ABC transporter G family member 2159.800%Swiss-ProtHigh
Q9SZR9Arabidopsis thalianasp|Q9SZR9|AB9G_ARATH ABC transporter G family member 953.400%Swiss-ProtHigh
Q93YS4Arabidopsis thalianasp|Q93YS4|AB22G_ARATH ABC transporter G family member 2250.600%Swiss-ProtHigh
Q9FT51Arabidopsis thalianasp|Q9FT51|AB27G_ARATH ABC transporter G family member 2749.800%Swiss-ProtMedium

JBrowse

View in Genome Browser