TkA01G002940 | RubberDandelionOmics

Gene overview

TkA01G002940

Reference: TK1151 Chr: Chr01 Coordinates: 764081-764500 Strand: + Type: protein_coding

cDNA / CDS / Protein Sequences

Available sequence downloads CDS FASTA Protein FASTA cDNA FASTA

cDNA

339 bp · TkA01G002940|TK1151|cDNA

ATGCACAGTTTCAATTTGGATCTAAGTCAATCTGATTTTCTGTTACATACTTGTAAAACTTGCGGATTCAAGTTTGCTCCTGGAGATGAAGACGATACAAAGGTTCACAAAGAATTTCACAAAAGTTACACTCATGGTATTCAATTCAAGGGTTGGTGTAATGAAAGAGTTATAGATACGCATTCATTAGAACATGGACGTGTTATTTTGGTACTTAATTGTGACATCCGCCTAAAACGGATTCGGGTCAACCCAATTCA...

CDS

Download CDS FASTA

339 bp · TkA01G002940|TK1151|CDS

ATGCACAGTTTCAATTTGGATCTAAGTCAATCTGATTTTCTGTTACATACTTGTAAAACTTGCGGATTCAAGTTTGCTCCTGGAGATGAAGACGATACAAAGGTTCACAAAGAATTTCACAAAAGTTACACTCATGGTATTCAATTCAAGGGTTGGTGTAATGAAAGAGTTATAGATACGCATTCATTAGAACATGGACGTGTTATTTTGGTACTTAATTGTGACATCCGCCTAAAACGGATTCGGGTCAACCCAATTCA...

Protein

Download Protein FASTA

112 aa · TkA01G002940|TK1151|PROTEIN

MHSFNLDLSQSDFLLHTCKTCGFKFAPGDEDDTKVHKEFHKSYTHGIQFKGWCNERVIDTHSLEHGRVILVLNCDIRLKRIRVNPIQLENPINSTQDHSTLIRSKPIHYDII

Flanking Sequence Download

Sequence orientation and download details

Upstream/downstream are capped at 10000 bp per side. Negative-strand genes are reverse-complemented so the final FASTA follows transcriptional 5′→3′ orientation.

ID Mapping

Input ID	`TkA01G002940`
TK1151 ID	TkA01G002940
OH-1004 ID	LXL04_032821
Relationship / confidence	Multi Source To Oh1004 / Complex relationship
Protein identity (%)	91.700
Protein coverage (%)	TK1151 64.286 / OH-1004 20.809 Coverage and evidence Coverage is the aligned span of the best-scoring HSP divided by representative protein length. A homolog match does not establish functional validation.
Source version	TK1151 / GWHBCHF00000000

Open Full ID Mapping

SNP / Indel variants and carrier samplesCRA009020 · TK1151

Expand to load variant records for this gene.

Basic Information and Functional Annotation

Gene ID	`TkA01G002940`
Location	Chr01:764081-764500 (+)
Description	Similar to CTF7: Protein CHROMOSOME TRANSMISSION FIDELITY 7
Arabidopsis / Rice Reference Genes and Papers	Download references for this gene Arabidopsis No hit for this species in the current source table. Rice No hit for this species in the current source table.
Functional annotation source	View annotation sources Functional annotation source: OH1004 · `LXL04_032821` · GCA_047496595.1_OSU_TarKok_2.0. These OH1004 annotations are retrieved through ID mapping; the Arabidopsis/rice table below uses protein alignments from the query reference.
GO annotations (OH1004 source)	GO:0000070 mitotic sister chromatid segregation Biological Process GO:0000278 mitotic cell cycle Biological Process GO:0000724 double-strand break repair via homologous recombination Biological Process GO:0006275 regulation of DNA replication Biological Process GO:0006281 DNA repair Biological Process GO:0006302 double-strand break repair Biological Process GO:0007059 chromosome segregation Biological Process GO:0007062 sister chromatid cohesion Biological Process GO:0007064 mitotic sister chromatid cohesion Biological Process GO:0009553 embryo sac development Biological Process GO:0009793 embryo development ending in seed dormancy Biological Process GO:0018394 peptidyl-lysine acetylation Biological Process
KEGG gene cross-reference	ath:AT4G31400 dre:445395 hsa:114799 hsa:157570 mmu:71988 These KEGG gene identifiers are linked through homologous proteins; they do not establish pathway function for this gene.

Open Annotation Module

Gene expression

View expression in different studies, tissues and treatments. Results are presented separately by study and measurement unit.

View expression for this gene

Data sources and gene correspondence

Expression data come from public transcriptome studies. Reference genomes, sample metadata and measurement units are shown with the results. Ambiguous cross-reference correspondences do not select an expression record automatically; missing values do not mean zero expression.

Subcellular Localization Top 5

Computational predictions or homology annotations below do not replace localization experiments.

Cytoplasm0.502

Rank 1 · TkA01G002940 · TK1151

Nucleus0.478

Rank 2 · TkA01G002940 · TK1151

Mitochondrion0.093

Rank 3 · TkA01G002940 · TK1151

Peroxisome0.040

Rank 4 · TkA01G002940 · TK1151

Cell membrane0.037

Rank 5 · TkA01G002940 · TK1151

LocPro · Direct prediction · Computational prediction, not experimental localization

Open Subcellular Module

Predicted Functional Domains

Domain results are from Pfam-A/HMMER; positions are amino-acid coordinates on the protein sequence.

PF13878zf-C2H2_36-41 aa

Gene ID	Domain ID	Domain Name	Start aa	End aa	E-value	Score
TkA01G002940	`PF13878`	zf-C2H2_3	6	41	1.4e-12	47.9

Arabidopsis / Rice Protein Homology

Only Arabidopsis and rice are shown. Swiss-Prot entries are reviewed; TrEMBL entries are supplementary sequence candidates. Similarity is not experimental validation.

Download current result

No result was found for this query.

JBrowse

View in Genome Browser

Gene Card