TkA01G000510 | RubberDandelionOmics

Gene overview

TkA01G000510

Reference: TK1151 Chr: Chr01 Coordinates: 114242-118685 Strand: - Type: protein_coding

cDNA / CDS / Protein Sequences

Available sequence downloads CDS FASTA Protein FASTA cDNA FASTA

cDNA

1899 bp · TkA01G000510|TK1151|cDNA

CTTGGGTGTAATCGGTTGATATGCCAATCTATATTTGGACCAAAAATACAGATTTACGAAAGAAAGGGACCATAAGTGTATACTACTTAAAGTAGAGCGTCATCACTGGAAACCAAACCAGTGGTCTGTTACCATTCTCTGTTTATTCACTCGCAAACTTCTATCATCTCAAATGGCGACCTCTTCCCTCCGGTTTGCATTCTCCCCTCTTATTCATACCCAAAGCTCCTCCAAACTCTTGTTCTCAATCCCTAATTATC...

CDS

Download CDS FASTA

1500 bp · TkA01G000510|TK1151|CDS

ATGGCGACCTCTTCCCTCCGGTTTGCATTCTCCCCTCTTATTCATACCCAAAGCTCCTCCAAACTCTTGTTCTCAATCCCTAATTATCAAACCAATTCGATCAGAATCCTCTGTTTCTCCGCCTCACCTCCTCCGTCAGGCACCACTCTCGAAACCCTAGCTCCTCCACCGCCGAGCCATTCCGTCAACAACATTAATCCTAATAAATGGGAGCCGTATCGGAAGAAGAAGGTGGTCATGCGCGTAGGCTACGTCGGCAC...

Protein

Download Protein FASTA

499 aa · TkA01G000510|TK1151|PROTEIN

MATSSLRFAFSPLIHTQSSSKLLFSIPNYQTNSIRILCFSASPPPSGTTLETLAPPPPSHSVNNINPNKWEPYRKKKVVMRVGYVGTDYKGLQMQKDDSISTVEKELETAIYKAGGIRDSNFGDLQKIAWARSSRTDKGVHSLSTMISLKMEIPESAWTGDPNGIALANLVNTYLPKNIRVFSILPSQRSFDARRECNIRKYSYLLPVEVIGITSNFNDSEIERHLSDFNHILNSFEGEHPFHNYTIRKNYRKKYSAKRG...

Flanking Sequence Download

Sequence orientation and download details

Upstream/downstream are capped at 10000 bp per side. Negative-strand genes are reverse-complemented so the final FASTA follows transcriptional 5′→3′ orientation.

ID Mapping

Input ID	`TkA01G000510`
TK1151 ID	TkA01G000510
OH-1004 ID	LXL04_036628
Relationship / confidence	Multi Source To Oh1004 / Complex relationship
Protein identity (%)	59.300
Protein coverage (%)	TK1151 98.397 / OH-1004 92.471 Coverage and evidence Coverage is the aligned span of the best-scoring HSP divided by representative protein length. A homolog match does not establish functional validation.
Source version	TK1151 / GWHBCHF00000000

Open Full ID Mapping

SNP / Indel variants and carrier samplesCRA009020 · TK1151

Expand to load variant records for this gene.

Basic Information and Functional Annotation

Gene ID TkA01G000510

Location Chr01:114242-118685 (-)

Description Similar to At2g30320: Putative tRNA pseudouridine synthase

Arabidopsis / Rice Reference Genes and Papers

Download references for this gene

Arabidopsis

Reference gene ID	Possible function	Papers / DOI
`At2g30320`	Putative tRNA pseudouridine synthase.	No verified direct reference in this release

Rice

No hit for this species in the current source table.

Functional annotation source

View annotation sources

Functional annotation source: OH1004 · LXL04_036628 · GCA_047496595.1_OSU_TarKok_2.0. These OH1004 annotations are retrieved through ID mapping; the Arabidopsis/rice table below uses protein alignments from the query reference.

GO annotations (OH1004 source)

GO:0006397 mRNA processing Biological Process

GO:0008380 RNA splicing Biological Process

GO:0031119 tRNA pseudouridine synthesis Biological Process

GO:0031120 snRNA pseudouridine synthesis Biological Process

GO:0070902 mitochondrial tRNA pseudouridine synthesis Biological Process

GO:1990481 mRNA pseudouridine synthesis Biological Process

GO:0005634 nucleus Cellular Component

GO:0005654 nucleoplasm Cellular Component

GO:0005667 transcription regulator complex Cellular Component

GO:0005730 nucleolus Cellular Component

GO:0005737 cytoplasm Cellular Component

GO:0005739 mitochondrion Cellular Component

KEGG gene cross-reference

ath:AT2G30320

cgr:2887466

hsa:80324

kla:KLLA0_B02244g

sce:YGL063W

These KEGG gene identifiers are linked through homologous proteins; they do not establish pathway function for this gene.

Open Annotation Module

Gene expression

View expression in different studies, tissues and treatments. Results are presented separately by study and measurement unit.

View expression for this gene

Data sources and gene correspondence

Expression data come from public transcriptome studies. Reference genomes, sample metadata and measurement units are shown with the results. Ambiguous cross-reference correspondences do not select an expression record automatically; missing values do not mean zero expression.

Subcellular Localization Top 5

Computational predictions or homology annotations below do not replace localization experiments.

Mitochondrion0.534

Rank 1 · TkA01G000510 · TK1151

Plastid0.227

Rank 2 · TkA01G000510 · TK1151

Nucleus0.213

Rank 3 · TkA01G000510 · TK1151

Cytoplasm0.073

Rank 4 · TkA01G000510 · TK1151

Peroxisome0.010

Rank 5 · TkA01G000510 · TK1151

LocPro · Direct prediction · Computational prediction, not experimental localization

Open Subcellular Module

Predicted Functional Domains

Domain results are from Pfam-A/HMMER; positions are amino-acid coordinates on the protein sequence.

PF12355Dscam_C51-65 aa

PF01416PseudoU_synth_184-147 aa

PF01416PseudoU_synth_1234-250 aa

PF12355Dscam_C241-312 aa

PF01416PseudoU_synth_1331-410 aa

Gene ID	Domain ID	Domain Name	Start aa	End aa	E-value	Score
TkA01G000510	`PF12355`	Dscam_C	51	65	0.14	13.8
TkA01G000510	`PF01416`	PseudoU_synth_1	84	147	1.8e-12	48.4
TkA01G000510	`PF01416`	PseudoU_synth_1	234	250	1.8e-12	48.4
TkA01G000510	`PF12355`	Dscam_C	241	312	0.14	13.8
TkA01G000510	`PF01416`	PseudoU_synth_1	331	410	1.8e-12	48.4

Arabidopsis / Rice Protein Homology

Only Arabidopsis and rice are shown. Swiss-Prot entries are reviewed; TrEMBL entries are supplementary sequence candidates. Similarity is not experimental validation.

Download current result

Protein	Organism	Description	Identity	Database	Confidence
`O22928`	Arabidopsis thaliana	sp\|O22928\|PUSH_ARATH Putative tRNA pseudouridine synthase	55.800%	Swiss-Prot	High

JBrowse

View in Genome Browser

Gene Card