LXL04_040170 | RubberDandelionOmics

Gene overview

LXL04_040170

Reference: OH-1004 Chr: JAJTUU010000520.1 Coordinates: 15515-17564 Strand: + Type: protein_coding

cDNA / CDS / Protein Sequences

Available sequence downloads CDS FASTA Protein FASTA cDNA FASTA

cDNA

1272 bp · LXL04_040170|LXL04_040170|OH1004|cDNA

ATGAATTGCCGAGTAGATAGATCAGATCCGGACGCGGCTGTTGCTCCGCGGCGATACGGACTCGACCCGCTCCTACCCACCCCGGGGCACCATAGCATGTCGGGAATAAGGGGGGACATACTGGACGTAACCACTCCCTTGGTTGGGGGCTGTGCCGCCCCGCCTTTCGATCGATACACAGTTGAGGAGGCCGATCACGAACGCTATAGGTGTGGGAGCGATCCTGGCCTGTTCGGACATAAGGTTCCCCCGGAAGATCA...

CDS

Download CDS FASTA

1272 bp · LXL04_040170|LXL04_040170|OH1004|CDS

ATGAATTGCCGAGTAGATAGATCAGATCCGGACGCGGCTGTTGCTCCGCGGCGATACGGACTCGACCCGCTCCTACCCACCCCGGGGCACCATAGCATGTCGGGAATAAGGGGGGACATACTGGACGTAACCACTCCCTTGGTTGGGGGCTGTGCCGCCCCGCCTTTCGATCGATACACAGTTGAGGAGGCCGATCACGAACGCTATAGGTGTGGGAGCGATCCTGGCCTGTTCGGACATAAGGTTCCCCCGGAAGATCA...

Protein

Download Protein FASTA

423 aa · LXL04_040170|LXL04_040170|OH1004|PROTEIN

MNCRVDRSDPDAAVAPRRYGLDPLLPTPGHHSMSGIRGDILDVTTPLVGGCAAPPFDRYTVEEADHERYRCGSDPGLFGHKVPPEDQVDEPCDGKPSRTADKAAIKAMLVNRVGDFGLAPGISGCFTLFQTVDFSTIFACASAPRNSWISRNMRLNAITLICILLLIGAAGKSAQIGSHTWSPDAMEGPTPVSALIHAATMVTAGVFMIARCSPLFEYPPTALIVITFAGAMTSFLAATTGILQNDLKRVIAYSTCSQLG...

Flanking Sequence Download

Sequence orientation and download details

Upstream/downstream are capped at 10000 bp per side. Negative-strand genes are reverse-complemented so the final FASTA follows transcriptional 5′→3′ orientation.

ID Mapping

Input ID	`LXL04_040170`
Source version	OH-1004 / GCA_047496595.1_OSU_TarKok_2.0

Open Full ID Mapping

SNP / Indel variants and carrier samplesCRA009020 · OH-1004

Expand to load variant records for this gene.

Basic Information and Functional Annotation

Gene ID LXL04_040170

Location JAJTUU010000520.1:15515-17564 (+)

Description Similar to ND5: NADH-ubiquinone oxidoreductase chain 5

Arabidopsis / Rice Reference Genes and Papers

Download references for this gene

Arabidopsis

Reference gene ID	Possible function	Papers / DOI
`UniProt: P29388`	Core subunit of the mitochondrial membrane respiratory chain NADH dehydrogenase (Complex I) that is believed to belong to the minimal assembly required for catalysis.	No verified direct reference in this release

Rice

No hit for this species in the current source table.

Functional annotation source

View annotation sources

Functional annotation source: OH1004 · LXL04_040170 · GCA_047496595.1_OSU_TarKok_2.0.

GO annotations (OH1004 source)

GO:0015990 electron transport coupled proton transport Biological Process

GO:0042773 ATP synthesis coupled electron transport Biological Process

GO:0005743 mitochondrial inner membrane Cellular Component

GO:0009536 plastid Cellular Component

GO:0045271 respiratory chain complex I Cellular Component

GO:0003954 NADH dehydrogenase activity Molecular Function

GO:0008137 NADH dehydrogenase (ubiquinone) activity Molecular Function

KEGG gene cross-reference No functional description available

Open Annotation Module

Gene expression

View expression in different studies, tissues and treatments. Results are presented separately by study and measurement unit.

View expression for this gene

Data sources and gene correspondence

Expression data come from public transcriptome studies. Reference genomes, sample metadata and measurement units are shown with the results. Ambiguous cross-reference correspondences do not select an expression record automatically; missing values do not mean zero expression.

Subcellular Localization Top 5

Computational predictions or homology annotations below do not replace localization experiments.

Mitochondrion0.769

Rank 1 · LXL04_040170 · OH-1004

Cytoplasm0.080

Rank 2 · LXL04_040170 · OH-1004

Plastid0.073

Rank 3 · LXL04_040170 · OH-1004

Cell membrane0.037

Rank 4 · LXL04_040170 · OH-1004

Nucleus0.035

Rank 5 · LXL04_040170 · OH-1004

LocPro · Direct prediction · Computational prediction, not experimental localization

Open Subcellular Module

Predicted Functional Domains

Domain results are from Pfam-A/HMMER; positions are amino-acid coordinates on the protein sequence.

PF00361.26Proton_antipo_M99-360 aa

Gene ID	Domain ID	Domain Name	Start aa	End aa	E-value	Score
LXL04_040170	`PF00361.26`	Proton_antipo_M	99	360	1.5e-65	222.1

Arabidopsis / Rice Protein Homology

Only Arabidopsis and rice are shown. Swiss-Prot entries are reviewed; TrEMBL entries are supplementary sequence candidates. Similarity is not experimental validation.

Download current result

Protein	Organism	Description	Identity	Database	Confidence
`P29388`	Arabidopsis thaliana	NADH-ubiquinone oxidoreductase chain 5	94.118%	Swiss-Prot	strong database homology

JBrowse

View in Genome Browser

Gene Card