LXL04_038898 | RubberDandelionOmics

Gene overview

LXL04_038898

Reference: OH-1004 Chr: Chr09 Coordinates: 52773010-52774248 Strand: - Type: protein_coding

cDNA / CDS / Protein Sequences

Available sequence downloads CDS FASTA Protein FASTA cDNA FASTA

cDNA

432 bp · LXL04_038898|LXL04_038898|OH1004|cDNA

ATGAGCTTACTCGACCAATTCTGGGACGACACCGTCGCCGGGCCTCGGCCGGAGAAAGGCCTCGGAAAGCTGCGAAAACAGTCTACTTTTAGTTCCCGGTCATCGGATTCCGGCAAGGCAGAATCGCCGCCGGTCACAAATACGGCAGTAGAGGATCCCACGATGAGAGTAACACGAAGCATAATGATCGTAAAACCAGAAAGAACTCTGAGCGACACTCCGCCGTCATCTCCCGCCGGATCTACACCTCCGGTATCTCC...

CDS

Download CDS FASTA

432 bp · LXL04_038898|LXL04_038898|OH1004|CDS

ATGAGCTTACTCGACCAATTCTGGGACGACACCGTCGCCGGGCCTCGGCCGGAGAAAGGCCTCGGAAAGCTGCGAAAACAGTCTACTTTTAGTTCCCGGTCATCGGATTCCGGCAAGGCAGAATCGCCGCCGGTCACAAATACGGCAGTAGAGGATCCCACGATGAGAGTAACACGAAGCATAATGATCGTAAAACCAGAAAGAACTCTGAGCGACACTCCGCCGTCATCTCCCGCCGGATCTACACCTCCGGTATCTCC...

Protein

Download Protein FASTA

143 aa · LXL04_038898|LXL04_038898|OH1004|PROTEIN

MSLLDQFWDDTVAGPRPEKGLGKLRKQSTFSSRSSDSGKAESPPVTNTAVEDPTMRVTRSIMIVKPERTLSDTPPSSPAGSTPPVSPFPGKAVRFYQFPKMVPPPPEADQRHLGFVGSLHRTLSRRQAGLEPGALVLLTTCEI

Flanking Sequence Download

Sequence orientation and download details

Upstream/downstream are capped at 10000 bp per side. Negative-strand genes are reverse-complemented so the final FASTA follows transcriptional 5′→3′ orientation.

ID Mapping

Input ID	`LXL04_038898`
TK1151 ID	TkA04G475580
OH-1004 ID	LXL04_038898
Relationship / confidence	Rbh Below Probable Coverage Or Synteny Threshold / Review
Protein identity (%)	98.900
Protein coverage (%)	TK1151 70.400 / OH-1004 62.238 Coverage and evidence Coverage is the aligned span of the best-scoring HSP divided by representative protein length. A homolog match does not establish functional validation.
Source version	OH-1004 / GCA_047496595.1_OSU_TarKok_2.0

Open Full ID Mapping

SNP / Indel variants and carrier samplesCRA009020 · OH-1004

Expand to load variant records for this gene.

Basic Information and Functional Annotation

Gene ID LXL04_038898

Location Chr09:52773010-52774248 (-)

Description Similar to At1g56220: Dormancy-associated protein homolog 3

Arabidopsis / Rice Reference Genes and Papers

Download references for this gene

Arabidopsis

Reference gene ID	Possible function	Papers / DOI
`At1g56220`	Dormancy-associated protein homolog 3.	No verified direct reference in this release
`At1g54070`	Dormancy-associated protein homolog 4.	No verified direct reference in this release
`At1g28330`	Dormancy-associated protein 1.	No verified direct reference in this release

Rice

No hit for this species in the current source table.

Functional annotation source

View annotation sources

Functional annotation source: OH1004 · LXL04_038898 · GCA_047496595.1_OSU_TarKok_2.0.

GO annotations (OH1004 source)

GO:0009734 auxin-activated signaling pathway Biological Process

GO:0009744 response to sucrose Biological Process

GO:0009749 response to glucose Biological Process

GO:0009750 response to fructose Biological Process

GO:0005634 nucleus Cellular Component

KEGG gene cross-reference

ath:AT1G28330

ath:AT1G54070

ath:AT1G56220

These KEGG gene identifiers are linked through homologous proteins; they do not establish pathway function for this gene.

Open Annotation Module

Gene expression

View expression in different studies, tissues and treatments. Results are presented separately by study and measurement unit.

View expression for this gene

Data sources and gene correspondence

Expression data come from public transcriptome studies. Reference genomes, sample metadata and measurement units are shown with the results. Ambiguous cross-reference correspondences do not select an expression record automatically; missing values do not mean zero expression.

Subcellular Localization Top 5

Computational predictions or homology annotations below do not replace localization experiments.

Cytoplasm0.540

Rank 1 · LXL04_038898 · OH-1004

Nucleus0.287

Rank 2 · LXL04_038898 · OH-1004

Cell membrane0.192

Rank 3 · LXL04_038898 · OH-1004

Mitochondrion0.136

Rank 4 · LXL04_038898 · OH-1004

Golgi apparatus0.067

Rank 5 · LXL04_038898 · OH-1004

LocPro · Direct prediction · Computational prediction, not experimental localization

Open Subcellular Module

Predicted Functional Domains

Domain results are from Pfam-A/HMMER; positions are amino-acid coordinates on the protein sequence.

PF05564.18Auxin_repressed7-44 aa

Gene ID	Domain ID	Domain Name	Start aa	End aa	E-value	Score
LXL04_038898	`PF05564.18`	Auxin_repressed	7	44	2.6e-08	35.2

Arabidopsis / Rice Protein Homology

Only Arabidopsis and rice are shown. Swiss-Prot entries are reviewed; TrEMBL entries are supplementary sequence candidates. Similarity is not experimental validation.

Download current result

Protein	Organism	Description	Identity	Database	Confidence
`Q8LD26`	Arabidopsis thaliana	Dormancy-associated protein homolog 3	52.273%	Swiss-Prot	moderate database homology
`F4HV65`	Arabidopsis thaliana	Dormancy-associated protein homolog 4	41.429%	Swiss-Prot	weak database homology
`B9DGG8`	Arabidopsis thaliana	Dormancy-associated protein 1	47.826%	Swiss-Prot	weak database homology

JBrowse

View in Genome Browser

Gene Card