LXL04_038849 | RubberDandelionOmics

Gene overview

LXL04_038849

Reference: OH-1004 Chr: Chr09 Coordinates: 51978618-51981131 Strand: - Type: protein_coding

cDNA / CDS / Protein Sequences

Available sequence downloads CDS FASTA Protein FASTA cDNA FASTA

cDNA

2103 bp · LXL04_038849|LXL04_038849|OH1004|cDNA

ATGGATTATGACGTGTCAACACCCGCTCAATTTCTAAGAGATAGAGAAAGACAAGTGGTTCATCTGATTTGCTTGTTGACGGCCATTCTAACACAACGTATACTTGCCAACGCAAACCGTCCAAAGTTACCTTCTAGAAAACTTATTCGTAAACGTCGGCGTATACGTGAGGAGTTGTTAGACGACCTTCAAAATGGCGGTCACTGTCGCGATCAAATCCGTATGAGTGAGCATGCATTTAAGAAATTGTGCATTATCTT...

CDS

Download CDS FASTA

2103 bp · LXL04_038849|LXL04_038849|OH1004|CDS

ATGGATTATGACGTGTCAACACCCGCTCAATTTCTAAGAGATAGAGAAAGACAAGTGGTTCATCTGATTTGCTTGTTGACGGCCATTCTAACACAACGTATACTTGCCAACGCAAACCGTCCAAAGTTACCTTCTAGAAAACTTATTCGTAAACGTCGGCGTATACGTGAGGAGTTGTTAGACGACCTTCAAAATGGCGGTCACTGTCGCGATCAAATCCGTATGAGTGAGCATGCATTTAAGAAATTGTGCATTATCTT...

Protein

Download Protein FASTA

700 aa · LXL04_038849|LXL04_038849|OH1004|PROTEIN

MDYDVSTPAQFLRDRERQVVHLICLLTAILTQRILANANRPKLPSRKLIRKRRRIREELLDDLQNGGHCRDQIRMSEHAFKKLCIILQHDGGLRPTQRMSVVEQVARFLHIVGNDFRNRFVSSLYRRSKFTTSRCFHRVLCAVIALETHFIQQPKGDVVPKEIQEKKIFYPFFKNCVGAIDGTHVRVKVPNKDAPRYRGRKGYPTINVLAACTFDLKFTYILTGWEGTASDSRILRSALTREDKLVIPTGRYYLVDAGLP...

Flanking Sequence Download

Sequence orientation and download details

Upstream/downstream are capped at 10000 bp per side. Negative-strand genes are reverse-complemented so the final FASTA follows transcriptional 5′→3′ orientation.

ID Mapping

Input ID	`LXL04_038849`
Source version	OH-1004 / GCA_047496595.1_OSU_TarKok_2.0

Open Full ID Mapping

SNP / Indel variants and carrier samplesCRA009020 · OH-1004

Expand to load variant records for this gene.

Basic Information and Functional Annotation

Gene ID LXL04_038849

Location Chr09:51978618-51981131 (-)

Description Similar to Harbi1: Putative nuclease HARBI1

Arabidopsis / Rice Reference Genes and Papers

Download references for this gene

Arabidopsis

Reference gene ID	Possible function	Papers / DOI
`At3g55350`	Transposase-derived protein that may have nuclease activity.	No verified direct reference in this release

Rice

No hit for this species in the current source table.

Functional annotation source

View annotation sources

Functional annotation source: OH1004 · LXL04_038849 · GCA_047496595.1_OSU_TarKok_2.0.

GO annotations (OH1004 source)

GO:0000118 histone deacetylase complex Cellular Component

GO:0005634 nucleus Cellular Component

GO:0005829 cytosol Cellular Component

GO:0005886 plasma membrane Cellular Component

GO:0034451 centriolar satellite Cellular Component

GO:0004518 nuclease activity Molecular Function

GO:0016787 hydrolase activity Molecular Function

GO:0046872 metal ion binding Molecular Function

KEGG gene cross-reference

ath:AT3G55350

bta:514442

hsa:283254

mmu:241547

rno:690164

These KEGG gene identifiers are linked through homologous proteins; they do not establish pathway function for this gene.

Open Annotation Module

Gene expression

View expression in different studies, tissues and treatments. Results are presented separately by study and measurement unit.

View expression for this gene

Data sources and gene correspondence

Expression data come from public transcriptome studies. Reference genomes, sample metadata and measurement units are shown with the results. Ambiguous cross-reference correspondences do not select an expression record automatically; missing values do not mean zero expression.

Subcellular Localization Top 5

Computational predictions or homology annotations below do not replace localization experiments.

Nucleus0.950

Rank 1 · LXL04_038849 · OH-1004

Cytoplasm0.125

Rank 2 · LXL04_038849 · OH-1004

Mitochondrion0.019

Rank 3 · LXL04_038849 · OH-1004

Cell membrane0.016

Rank 4 · LXL04_038849 · OH-1004

Extracellular0.010

Rank 5 · LXL04_038849 · OH-1004

LocPro · Direct prediction · Computational prediction, not experimental localization

Open Subcellular Module

Predicted Functional Domains

Domain results are from Pfam-A/HMMER; positions are amino-acid coordinates on the protein sequence.

PF26138.1DUF804065-144 aa

PF04827.21Plant_tran173-350 aa

PF01609.28DDE_Tnp_1174-317 aa

PF13359.13DDE_Tnp_4180-341 aa

PF12776.14Myb_DNA-bind_3397-488 aa

Gene ID	Domain ID	Domain Name	Start aa	End aa	E-value	Score
LXL04_038849	`PF26138.1`	DUF8040	65	144	4.4e-20	72.1
LXL04_038849	`PF04827.21`	Plant_tran	173	350	6.9e-15	55.9
LXL04_038849	`PF01609.28`	DDE_Tnp_1	174	317	5.2e-07	30.3
LXL04_038849	`PF13359.13`	DDE_Tnp_4	180	341	3.4e-27	95.7
LXL04_038849	`PF12776.14`	Myb_DNA-bind_3	397	488	1.5e-21	77.8

Arabidopsis / Rice Protein Homology

Only Arabidopsis and rice are shown. Swiss-Prot entries are reviewed; TrEMBL entries are supplementary sequence candidates. Similarity is not experimental validation.

Download current result

Protein	Organism	Description	Identity	Database	Confidence
`Q9M2U3`	Arabidopsis thaliana	Protein ALP1-like	22.899%	Swiss-Prot	weak database homology

JBrowse

View in Genome Browser

Gene Card