LXL04_038121 | RubberDandelionOmics

Gene overview

LXL04_038121

Reference: OH-1004 Chr: Chr09 Coordinates: 31722578-31722877 Strand: + Type: protein_coding

cDNA / CDS / Protein Sequences

Available sequence downloads CDS FASTA Protein FASTA cDNA FASTA

cDNA

300 bp · LXL04_038121|LXL04_038121|OH1004|cDNA

ATGTCGGAAATGGGCGAAATAAAGGTTCTTGGCGGCACTGCAAGTCCATTTGTGAACAGGGTTCAGTTTGTTCTTAATCTTAAATCTATCAAATACGAGTTCATGGAGGAAGATTTCGATAACAAAAGCGAGCTCCTGTTGACATCGAACCCAGTTTTTAAAAGAGTCCCTGTTCTTATACATTCAAACAAACCGCCGGTGGACAGATCGGAGCAATTGAATCAGGAAGATGGATTCATTCCTACATTTAAAACCATAAA...

CDS

Download CDS FASTA

300 bp · LXL04_038121|LXL04_038121|OH1004|CDS

ATGTCGGAAATGGGCGAAATAAAGGTTCTTGGCGGCACTGCAAGTCCATTTGTGAACAGGGTTCAGTTTGTTCTTAATCTTAAATCTATCAAATACGAGTTCATGGAGGAAGATTTCGATAACAAAAGCGAGCTCCTGTTGACATCGAACCCAGTTTTTAAAAGAGTCCCTGTTCTTATACATTCAAACAAACCGCCGGTGGACAGATCGGAGCAATTGAATCAGGAAGATGGATTCATTCCTACATTTAAAACCATAAA...

Protein

Download Protein FASTA

99 aa · LXL04_038121|LXL04_038121|OH1004|PROTEIN

MSEMGEIKVLGGTASPFVNRVQFVLNLKSIKYEFMEEDFDNKSELLLTSNPVFKRVPVLIHSNKPPVDRSEQLNQEDGFIPTFKTIKFKSTSRIRLKRQ

Flanking Sequence Download

Sequence orientation and download details

Upstream/downstream are capped at 10000 bp per side. Negative-strand genes are reverse-complemented so the final FASTA follows transcriptional 5′→3′ orientation.

ID Mapping

Input ID	`LXL04_038121`
Source version	OH-1004 / GCA_047496595.1_OSU_TarKok_2.0

Open Full ID Mapping

SNP / Indel variants and carrier samplesCRA009020 · OH-1004

Expand to load variant records for this gene.

Basic Information and Functional Annotation

Gene ID LXL04_038121

Location Chr09:31722578-31722877 (+)

Description Similar to Probable glutathione S-transferase

Arabidopsis / Rice Reference Genes and Papers

Download references for this gene

Arabidopsis

Reference gene ID	Possible function	Papers / DOI
`At1g10370`	Involved in light signaling, mainly phyA-mediated photomorphogenesis and in the integration of various phytohormone signals to modulate various aspects of plant development by affecting glutathione pools.	A glutathione S-transferase regulated by light and hormones participates in the modulation of Arabidopsis seedling development.2010 · DOI: 10.1104/pp.110.159152

Rice

Reference gene ID	Possible function	Papers / DOI
`Os10g0530900`	Conjugation of reduced glutathione to a wide number of exogenous and endogenous hydrophobic electrophiles.	No verified direct reference in this release

Functional annotation source

View annotation sources

Functional annotation source: OH1004 · LXL04_038121 · GCA_047496595.1_OSU_TarKok_2.0.

GO annotations (OH1004 source)

GO:0006749 glutathione metabolic process Biological Process

GO:0009407 toxin catabolic process Biological Process

GO:0009651 response to salt stress Biological Process

GO:0009704 de-etiolation Biological Process

GO:0009734 auxin-activated signaling pathway Biological Process

GO:0048527 lateral root development Biological Process

GO:0060416 response to growth hormone Biological Process

GO:0080148 negative regulation of response to water deprivation Biological Process

GO:0005737 cytoplasm Cellular Component

GO:0005829 cytosol Cellular Component

GO:0009507 chloroplast Cellular Component

GO:0004364 glutathione transferase activity Molecular Function

KEGG gene cross-reference

ath:AT1G10370

dosa:Os10g0530900

nta:107765700

nta:107800866

nta:107802704

These KEGG gene identifiers are linked through homologous proteins; they do not establish pathway function for this gene.

Open Annotation Module

Gene expression

View expression in different studies, tissues and treatments. Results are presented separately by study and measurement unit.

View expression for this gene

Data sources and gene correspondence

Expression data come from public transcriptome studies. Reference genomes, sample metadata and measurement units are shown with the results. Ambiguous cross-reference correspondences do not select an expression record automatically; missing values do not mean zero expression.

Subcellular Localization Top 5

Computational predictions or homology annotations below do not replace localization experiments.

Cytoplasm0.536

Rank 1 · LXL04_038121 · OH-1004

Nucleus0.249

Rank 2 · LXL04_038121 · OH-1004

Mitochondrion0.182

Rank 3 · LXL04_038121 · OH-1004

Peroxisome0.091

Rank 4 · LXL04_038121 · OH-1004

Extracellular0.050

Rank 5 · LXL04_038121 · OH-1004

LocPro · Direct prediction · Computational prediction, not experimental localization

Open Subcellular Module

Predicted Functional Domains

Domain results are from Pfam-A/HMMER; positions are amino-acid coordinates on the protein sequence.

PF02798.27GST_N7-64 aa

PF13417.13GST_N_314-63 aa

PF13409.13GST_N_214-68 aa

Gene ID	Domain ID	Domain Name	Start aa	End aa	E-value	Score
LXL04_038121	`PF02798.27`	GST_N	7	64	5.4e-09	37.0
LXL04_038121	`PF13417.13`	GST_N_3	14	63	2.6e-06	28.4
LXL04_038121	`PF13409.13`	GST_N_2	14	68	3e-06	28.5

Arabidopsis / Rice Protein Homology

Only Arabidopsis and rice are shown. Swiss-Prot entries are reviewed; TrEMBL entries are supplementary sequence candidates. Similarity is not experimental validation.

Download current result

Protein	Organism	Description	Identity	Database	Confidence
`Q9FUS8`	Arabidopsis thaliana	Glutathione S-transferase U17	58.333%	Swiss-Prot	moderate database homology
`Q06398`	Oryza sativa subsp. japonica	Probable glutathione S-transferase GSTU6	52.000%	Swiss-Prot	strong database homology

JBrowse

View in Genome Browser

Gene Card