LXL04_038006 | RubberDandelionOmics

Gene overview

LXL04_038006

Reference: OH-1004 Chr: Chr09 Coordinates: 28007840-28008767 Strand: - Type: protein_coding

cDNA / CDS / Protein Sequences

Available sequence downloads CDS FASTA Protein FASTA cDNA FASTA

cDNA

660 bp · LXL04_038006|LXL04_038006|OH1004|cDNA

ATGTTTCACATCAATACAGTTCCCCAGAATTTGTCGCTGACTCCCACTCTTAACCACAGTGATCACGATCTAATGGCGCAGCCTCCTCGTTCTTCAGGTGAGATTCATGTCATCGTTGGGCCTATGTTCGCCGGTAAAACCACCGCTCTTCTTCGCCGGATCAAAACCGAAGGCACAAACGGCAGGAATATAGCGATGATAAAATCAAGCAAGGATACACGATACGCAGTTAATTCAGTTGTAACACACGATGGGACGAA...

CDS

Download CDS FASTA

660 bp · LXL04_038006|LXL04_038006|OH1004|CDS

ATGTTTCACATCAATACAGTTCCCCAGAATTTGTCGCTGACTCCCACTCTTAACCACAGTGATCACGATCTAATGGCGCAGCCTCCTCGTTCTTCAGGTGAGATTCATGTCATCGTTGGGCCTATGTTCGCCGGTAAAACCACCGCTCTTCTTCGCCGGATCAAAACCGAAGGCACAAACGGCAGGAATATAGCGATGATAAAATCAAGCAAGGATACACGATACGCAGTTAATTCAGTTGTAACACACGATGGGACGAA...

Protein

Download Protein FASTA

219 aa · LXL04_038006|LXL04_038006|OH1004|PROTEIN

MFHINTVPQNLSLTPTLNHSDHDLMAQPPRSSGEIHVIVGPMFAGKTTALLRRIKTEGTNGRNIAMIKSSKDTRYAVNSVVTHDGTKYPCCALPDLLSFKQKFGEEAYEKLDVIGIDEAQFFDDLYEFCSKAADDDGKTIIVAGLDGDYLRRNFGPVLDIVPLADTITKLTARCEVCGKKAHFTFRKTKETKTELIGGADMYMPVCRQHYVNGQVVIKH

Flanking Sequence Download

Sequence orientation and download details

Upstream/downstream are capped at 10000 bp per side. Negative-strand genes are reverse-complemented so the final FASTA follows transcriptional 5′→3′ orientation.

ID Mapping

Input ID	`LXL04_038006`
Source version	OH-1004 / GCA_047496595.1_OSU_TarKok_2.0

Open Full ID Mapping

SNP / Indel variants and carrier samplesCRA009020 · OH-1004

Expand to load variant records for this gene.

Basic Information and Functional Annotation

Gene ID LXL04_038006

Location Chr09:28007840-28008767 (-)

Description Similar to TK1A: Thymidine kinase a

Arabidopsis / Rice Reference Genes and Papers

Download references for this gene

Arabidopsis

Reference gene ID	Possible function	Papers / DOI
`At3g07800`	Part of the salvage pathway for purine and pyrimidine deoxyribonucleotide synthesis.	Two thymidine kinases and one multisubstrate deoxyribonucleoside kinase salvage DNA precursors in Arabidopsis thaliana.2012 · DOI: 10.1111/j.1742-4658.2012.08747.x Arabidopsis thaliana thymidine kinase 1a is ubiquitously expressed during development and contributes to confer tolerance to genotoxic stress.2015 · DOI: 10.1007/s11103-014-0277-7
`At5g23070`	Part of the salvage pathway for purine and pyrimidine deoxyribonucleotide synthesis.	Two thymidine kinases and one multisubstrate deoxyribonucleoside kinase salvage DNA precursors in Arabidopsis thaliana.2012 · DOI: 10.1111/j.1742-4658.2012.08747.x

Rice

Reference gene ID	Possible function	Papers / DOI
`Os03g0113100`	Thymidine kinase.	No verified direct reference in this release

Functional annotation source

View annotation sources

Functional annotation source: OH1004 · LXL04_038006 · GCA_047496595.1_OSU_TarKok_2.0.

GO annotations (OH1004 source)

GO:0006302 double-strand break repair Biological Process

GO:0006950 response to stress Biological Process

GO:0009409 response to cold Biological Process

GO:0010225 response to UV-C Biological Process

GO:0046104 thymidine metabolic process Biological Process

GO:0046105 thymidine biosynthetic process Biological Process

GO:0051289 protein homotetramerization Biological Process

GO:0071897 DNA biosynthetic process Biological Process

GO:0090351 seedling development Biological Process

GO:1904860 DNA synthesis involved in mitotic DNA replication Biological Process

GO:0005634 nucleus Cellular Component

GO:0005737 cytoplasm Cellular Component

KEGG gene cross-reference

ath:AT3G07800

ath:AT5G23070

gga:395719

mmu:21877

These KEGG gene identifiers are linked through homologous proteins; they do not establish pathway function for this gene.

Open Annotation Module

Gene expression

View expression in different studies, tissues and treatments. Results are presented separately by study and measurement unit.

View expression for this gene

Data sources and gene correspondence

Expression data come from public transcriptome studies. Reference genomes, sample metadata and measurement units are shown with the results. Ambiguous cross-reference correspondences do not select an expression record automatically; missing values do not mean zero expression.

Subcellular Localization Top 5

Computational predictions or homology annotations below do not replace localization experiments.

Cytoplasm0.604

Rank 1 · LXL04_038006 · OH-1004

Nucleus0.540

Rank 2 · LXL04_038006 · OH-1004

Mitochondrion0.083

Rank 3 · LXL04_038006 · OH-1004

Cell membrane0.033

Rank 4 · LXL04_038006 · OH-1004

Endoplasmic reticulum0.025

Rank 5 · LXL04_038006 · OH-1004

LocPro · Direct prediction · Computational prediction, not experimental localization

Open Subcellular Module

Predicted Functional Domains

Domain results are from Pfam-A/HMMER; positions are amino-acid coordinates on the protein sequence.

PF00265.25TK33-210 aa

Gene ID	Domain ID	Domain Name	Start aa	End aa	E-value	Score
LXL04_038006	`PF00265.25`	TK	33	210	1.5e-55	188.5

Arabidopsis / Rice Protein Homology

Only Arabidopsis and rice are shown. Swiss-Prot entries are reviewed; TrEMBL entries are supplementary sequence candidates. Similarity is not experimental validation.

Download current result

Protein	Organism	Description	Identity	Database	Confidence
`Q9S750`	Arabidopsis thaliana	Thymidine kinase a	73.016%	Swiss-Prot	strong database homology
`F4KBF5`	Arabidopsis thaliana	Thymidine kinase b	70.588%	Swiss-Prot	strong database homology
`O81263`	Oryza sativa subsp. japonica	Thymidine kinase	72.308%	Swiss-Prot	strong database homology

JBrowse

View in Genome Browser

Gene Card