LXL04_037135 | RubberDandelionOmics

Gene overview

LXL04_037135

Reference: OH-1004 Chr: Chr08 Coordinates: 53796173-53797687 Strand: + Type: protein_coding

cDNA / CDS / Protein Sequences

Available sequence downloads CDS FASTA Protein FASTA cDNA FASTA

cDNA

1305 bp · LXL04_037135|LXL04_037135|OH1004|cDNA

ATGAAGGGATGCCAACGCAATAATTACTTAAACAGTACCCCCATGGAATTCAGTGTCACCAAATCCAATGGAAGCTTGGTTCCACCTTCTGGACCAACACCGTCGACCGTGCTTGATTTATCACGAATTGATAGAGTACCGGTACTGAGATGCAATGCACGGACACTTCACGTGTTTGAGGCAATGGGTGCTCCTGGAGCCGCAATATCAAGAATACGTGAGGCCTTATCCAAGGCGCTGGTCCCTTACTATCCTCTAGC...

CDS

Download CDS FASTA

1299 bp · LXL04_037135|LXL04_037135|OH1004|CDS

ATGAAGGGATGCCAACGCAATAATTACTTAAACAGTACCCCCATGGAATTCAGTGTCACCAAATCCAATGGAAGCTTGGTTCCACCTTCTGGACCAACACCGTCGACCGTGCTTGATTTATCACGAATTGATAGAGTACCGGTACTGAGATGCAATGCACGGACACTTCACGTGTTTGAGGCAATGGGTGCTCCTGGAGCCGCAATATCAAGAATACGTGAGGCCTTATCCAAGGCGCTGGTCCCTTACTATCCTCTAGC...

Protein

Download Protein FASTA

432 aa · LXL04_037135|LXL04_037135|OH1004|PROTEIN

MKGCQRNNYLNSTPMEFSVTKSNGSLVPPSGPTPSTVLDLSRIDRVPVLRCNARTLHVFEAMGAPGAAISRIREALSKALVPYYPLAGRLTQLNPLELQVECSAQGVWFVEASATCTLQSVGYFDDITSIPFDNLLPHHPPENQGIDPLVLMQVTEFEGDGFVMGLTFCHTICDGLGAAQFLNAIGELARGVQHLKVSPVWQRDFLRQPQTVSLPPPPSMVLPDYELEQVNIDIPLDHINRMKQNFAGHCSSFEIVAAIL...

Flanking Sequence Download

Sequence orientation and download details

Upstream/downstream are capped at 10000 bp per side. Negative-strand genes are reverse-complemented so the final FASTA follows transcriptional 5′→3′ orientation.

ID Mapping

Input ID	`LXL04_037135`
Source version	OH-1004 / GCA_047496595.1_OSU_TarKok_2.0

Open Full ID Mapping

SNP / Indel variants and carrier samplesCRA009020 · OH-1004

Expand to load variant records for this gene.

Basic Information and Functional Annotation

Gene ID LXL04_037135

Location Chr08:53796173-53797687 (+)

Description Similar to AT4: Acyl transferase 4

Arabidopsis / Rice Reference Genes and Papers

Download references for this gene

Arabidopsis

No hit for this species in the current source table.

Rice

Reference gene ID	Possible function	Papers / DOI
`Os01g0291500`	Grass-specific monolignol p-coumaroyl transferase involved in the biosynthesis of acylated monolignols or monolignol conjugates that serve as monomer precursors of lignin.	No verified direct reference in this release
`Os01g0185300`	Involved in the incorporation of ferulate into the cell wall.	No verified direct reference in this release
`Os05g0278500`	Involved in the incorporation of ferulate into the cell wall.	No verified direct reference in this release
`Os05g0179300`	Involved in the incorporation of ferulate into the cell wall.	No verified direct reference in this release

Functional annotation source

View annotation sources

Functional annotation source: OH1004 · LXL04_037135 · GCA_047496595.1_OSU_TarKok_2.0.

GO annotations (OH1004 source)

GO:0009809 lignin biosynthetic process Biological Process

GO:0016746 acyltransferase activity Molecular Function

GO:0050734 hydroxycinnamoyltransferase activity Molecular Function

KEGG gene cross-reference

dosa:Os01g0185300

dosa:Os01g0291500

dosa:Os05g0179300

dosa:Os05g0278500

osa:4325654

These KEGG gene identifiers are linked through homologous proteins; they do not establish pathway function for this gene.

Open Annotation Module

Gene expression

View expression in different studies, tissues and treatments. Results are presented separately by study and measurement unit.

View expression for this gene

Data sources and gene correspondence

Expression data come from public transcriptome studies. Reference genomes, sample metadata and measurement units are shown with the results. Ambiguous cross-reference correspondences do not select an expression record automatically; missing values do not mean zero expression.

Subcellular Localization Top 5

Computational predictions or homology annotations below do not replace localization experiments.

Cytoplasm0.529

Rank 1 · LXL04_037135 · OH-1004

Nucleus0.248

Rank 2 · LXL04_037135 · OH-1004

Endoplasmic reticulum0.128

Rank 3 · LXL04_037135 · OH-1004

Plastid0.103

Rank 4 · LXL04_037135 · OH-1004

Cell membrane0.102

Rank 5 · LXL04_037135 · OH-1004

LocPro · Direct prediction · Computational prediction, not experimental localization

Open Subcellular Module

Predicted Functional Domains

Domain results are from Pfam-A/HMMER; positions are amino-acid coordinates on the protein sequence.

PF02458.21Transferase18-389 aa

Gene ID	Domain ID	Domain Name	Start aa	End aa	E-value	Score
LXL04_037135	`PF02458.21`	Transferase	18	389	5.5e-58	197.4

Arabidopsis / Rice Protein Homology

Only Arabidopsis and rice are shown. Swiss-Prot entries are reviewed; TrEMBL entries are supplementary sequence candidates. Similarity is not experimental validation.

Download current result

Protein	Organism	Description	Identity	Database	Confidence
`Q5JNT2`	Oryza sativa subsp. japonica	Acyl transferase 4	42.032%	Swiss-Prot	moderate database homology
`Q9LGQ6`	Oryza sativa subsp. japonica	Acyl transferase 9	36.706%	Swiss-Prot	moderate database homology
`Q0DJH7`	Oryza sativa subsp. japonica	Acyl transferase 5	41.218%	Swiss-Prot	moderate database homology
`Q0DKA5`	Oryza sativa subsp. japonica	Acyl transferase 7	39.631%	Swiss-Prot	moderate database homology

JBrowse

View in Genome Browser

Gene Card