LXL04_036986 | RubberDandelionOmics

Gene overview

LXL04_036986

Reference: OH-1004 Chr: Chr08 Coordinates: 51252224-51259674 Strand: - Type: protein_coding

cDNA / CDS / Protein Sequences

Available sequence downloads CDS FASTA Protein FASTA cDNA FASTA

cDNA

4038 bp · LXL04_036986|LXL04_036986|OH1004|cDNA

ATGGCAAAAATGTCAATGGCACAAATTGAAAATATGGGCACATTAAGCAGCGATCTCTTCTACGACATTCTAAAACGTCTCGATGGTGCAACCCTAGCTAGTGCATCATGCGCATGTGCAGCTTTTAGTTCAATGTCAAAAGAAGAGCGATTATGGGAAGATGTATGTTCTTCAATGTGGCCTTCAACAAAAAGAGACGACGTCAGAAACTTGATTCTATCAATCGGCGGATTTAAAAAATTCTATGGAGATTGTTTCCC...

CDS

Download CDS FASTA

4038 bp · LXL04_036986|LXL04_036986|OH1004|CDS

ATGGCAAAAATGTCAATGGCACAAATTGAAAATATGGGCACATTAAGCAGCGATCTCTTCTACGACATTCTAAAACGTCTCGATGGTGCAACCCTAGCTAGTGCATCATGCGCATGTGCAGCTTTTAGTTCAATGTCAAAAGAAGAGCGATTATGGGAAGATGTATGTTCTTCAATGTGGCCTTCAACAAAAAGAGACGACGTCAGAAACTTGATTCTATCAATCGGCGGATTTAAAAAATTCTATGGAGATTGTTTCCC...

Protein

Download Protein FASTA

1345 aa · LXL04_036986|LXL04_036986|OH1004|PROTEIN

MAKMSMAQIENMGTLSSDLFYDILKRLDGATLASASCACAAFSSMSKEERLWEDVCSSMWPSTKRDDVRNLILSIGGFKKFYGDCFPLIVNKEVPESRWSEYPEDYEELSEAEYYGDVDEFENVSPSDFVSMVDIKYKDKTICSKVIWGIPNANGFNGWFSNCPFRIDLFSFTGEGDDHTGGVTLSVTDGLPMVTSMERERKDGKLWKHLGDGMRLSWIVVNKKVKQAANLSSWSALTGQRHFPTDKDFLLRFGSILPAK...

Flanking Sequence Download

Sequence orientation and download details

Upstream/downstream are capped at 10000 bp per side. Negative-strand genes are reverse-complemented so the final FASTA follows transcriptional 5′→3′ orientation.

ID Mapping

Input ID	`LXL04_036986`
Source version	OH-1004 / GCA_047496595.1_OSU_TarKok_2.0

Open Full ID Mapping

SNP / Indel variants and carrier samplesCRA009020 · OH-1004

Expand to load variant records for this gene.

Basic Information and Functional Annotation

Gene ID LXL04_036986

Location Chr08:51252224-51259674 (-)

Description Similar to VPS11: Vacuolar protein-sorting-associated protein 11 homolog

Arabidopsis / Rice Reference Genes and Papers

Download references for this gene

Arabidopsis

Reference gene ID	Possible function	Papers / DOI
`At2g05170`	Involved in regulating membrane fusion at the tonoplast and the prevacuolar compartment.	The AtC-VPS protein complex is localized to the tonoplast and the prevacuolar compartment in arabidopsis.2003 · DOI: 10.1091/mbc.e02-08-0509

Rice

No hit for this species in the current source table.

Functional annotation source

View annotation sources

Functional annotation source: OH1004 · LXL04_036986 · GCA_047496595.1_OSU_TarKok_2.0.

GO annotations (OH1004 source)

GO:0006886 intracellular protein transport Biological Process

GO:0006904 vesicle docking involved in exocytosis Biological Process

GO:0007032 endosome organization Biological Process

GO:0007033 vacuole organization Biological Process

GO:0008333 endosome to lysosome transport Biological Process

GO:0016192 vesicle-mediated transport Biological Process

GO:0016567 protein ubiquitination Biological Process

GO:0031647 regulation of protein stability Biological Process

GO:0032889 regulation of vacuole fusion, non-autophagic Biological Process

GO:0033147 negative regulation of intracellular estrogen receptor signaling pathway Biological Process

GO:0034058 endosomal vesicle fusion Biological Process

GO:0035542 regulation of SNARE complex assembly Biological Process

KEGG gene cross-reference

ath:AT2G05170

cel:CELE_R06F6.2

ddi:DDB_G0278141

hsa:55823

mmu:71732

These KEGG gene identifiers are linked through homologous proteins; they do not establish pathway function for this gene.

Open Annotation Module

Gene expression

View expression in different studies, tissues and treatments. Results are presented separately by study and measurement unit.

View expression for this gene

Data sources and gene correspondence

Expression data come from public transcriptome studies. Reference genomes, sample metadata and measurement units are shown with the results. Ambiguous cross-reference correspondences do not select an expression record automatically; missing values do not mean zero expression.

Subcellular Localization Top 5

Computational predictions or homology annotations below do not replace localization experiments.

Cytoplasm0.451

Rank 1 · LXL04_036986 · OH-1004

Nucleus0.287

Rank 2 · LXL04_036986 · OH-1004

Golgi apparatus0.182

Rank 3 · LXL04_036986 · OH-1004

Endoplasmic reticulum0.138

Rank 4 · LXL04_036986 · OH-1004

Cell membrane0.125

Rank 5 · LXL04_036986 · OH-1004

LocPro · Direct prediction · Computational prediction, not experimental localization

Open Subcellular Module

Predicted Functional Domains

Domain results are from Pfam-A/HMMER; positions are amino-acid coordinates on the protein sequence.

PF23341.2PEP5_VPS11_N426-758 aa

PF23266.2VPS11_N448-753 aa

PF28737.1VPS18_solenoid_2nd768-916 aa

PF23356.2TPR_PEP5_VPS11803-1190 aa

PF23556.2TPR_Vps41809-939 aa

PF00637.27Clathrin823-961 aa

PF28737.1VPS18_solenoid_2nd927-1121 aa

PF17122.11zf-C3H2C31254-1289 aa

Gene ID	Domain ID	Domain Name	Start aa	End aa	E-value	Score
LXL04_036986	`PF23341.2`	PEP5_VPS11_N	426	758	3.5e-90	303.3
LXL04_036986	`PF23266.2`	VPS11_N	448	753	5.1e-113	378.0
LXL04_036986	`PF28737.1`	VPS18_solenoid_2nd	768	916	2.4e-15	57.7
LXL04_036986	`PF23356.2`	TPR_PEP5_VPS11	803	1190	2e-85	287.8
LXL04_036986	`PF23556.2`	TPR_Vps41	809	939	1.7e-08	34.8
LXL04_036986	`PF00637.27`	Clathrin	823	961	3.3e-12	47.1
LXL04_036986	`PF28737.1`	VPS18_solenoid_2nd	927	1121	2.4e-15	57.7
LXL04_036986	`PF17122.11`	zf-C3H2C3	1254	1289	2e-06	28.5
LXL04_036986	`PF12451.14`	VPS11_C	1294	1336	5.3e-14	52.8

Arabidopsis / Rice Protein Homology

Only Arabidopsis and rice are shown. Swiss-Prot entries are reviewed; TrEMBL entries are supplementary sequence candidates. Similarity is not experimental validation.

Download current result

Protein	Organism	Description	Identity	Database	Confidence
`Q9SJ40`	Arabidopsis thaliana	Vacuolar protein-sorting-associated protein 11 homolog	75.581%	Swiss-Prot	moderate database homology

JBrowse

View in Genome Browser

Gene Card