LXL04_036629 | RubberDandelionOmics

Gene overview

LXL04_036629

Reference: OH-1004 Chr: Chr08 Coordinates: 45675340-45680516 Strand: + Type: protein_coding

cDNA / CDS / Protein Sequences

Available sequence downloads CDS FASTA Protein FASTA cDNA FASTA

cDNA

3084 bp · LXL04_036629|LXL04_036629|OH1004|cDNA

ATGAACCCTTCGATTCTTCTGACACAACAACCATCCTCTCCTCACCCAACCATCTTGTTCACTCCATTTCTCAACCCTACACCTCTCAAAGTCACAACCAAATTTCTCACCTTCAATCACCGTCGGCACAGATACAGCTGCCGTGCGCCTTCCGTCCGTTGCTCGGTATCTTCATCCTCAGTAGACCAACCAACCACCACCGCTCCGGTAAACGATGTGTTTGGAGGGAAGAAGGAGCTGTCGGCATTCCAATCACTTGT...

CDS

Download CDS FASTA

3084 bp · LXL04_036629|LXL04_036629|OH1004|CDS

ATGAACCCTTCGATTCTTCTGACACAACAACCATCCTCTCCTCACCCAACCATCTTGTTCACTCCATTTCTCAACCCTACACCTCTCAAAGTCACAACCAAATTTCTCACCTTCAATCACCGTCGGCACAGATACAGCTGCCGTGCGCCTTCCGTCCGTTGCTCGGTATCTTCATCCTCAGTAGACCAACCAACCACCACCGCTCCGGTAAACGATGTGTTTGGAGGGAAGAAGGAGCTGTCGGCATTCCAATCACTTGT...

Protein

Download Protein FASTA

1027 aa · LXL04_036629|LXL04_036629|OH1004|PROTEIN

MNPSILLTQQPSSPHPTILFTPFLNPTPLKVTTKFLTFNHRRHRYSCRAPSVRCSVSSSSVDQPTTTAPVNDVFGGKKELSAFQSLVDSMSPAVRLASSVVVVAGAVAAGYGLGLRIGGTRNASLGGAVVLGAAGAGAVYALNSSVPEIAALSLHNYVAGSDPGALKKEDIESIASRYGVSKQNEAFNAELCDIYCRYVTSVLPSGGEDLKGNEADIIMKFKSSLGIDDPDAAAMHMEIGRRIFRQRLETGDREADAEQR...

Flanking Sequence Download

Sequence orientation and download details

Upstream/downstream are capped at 10000 bp per side. Negative-strand genes are reverse-complemented so the final FASTA follows transcriptional 5′→3′ orientation.

ID Mapping

Input ID	`LXL04_036629`
TK1151 ID	TkA01G000550
OH-1004 ID	LXL04_036629
Relationship / confidence	Rbh High Identity Coverage Local Synteny Minor Chr Pair / Probable
Protein identity (%)	97.500
Protein coverage (%)	TK1151 100.000 / OH-1004 100.000 Coverage and evidence Coverage is the aligned span of the best-scoring HSP divided by representative protein length. A homolog match does not establish functional validation.
Source version	OH-1004 / GCA_047496595.1_OSU_TarKok_2.0

Open Full ID Mapping

SNP / Indel variants and carrier samplesCRA009020 · OH-1004

Expand to load variant records for this gene.

Basic Information and Functional Annotation

Gene ID LXL04_036629

Location Chr08:45675340-45680516 (+)

Description Similar to TIC110: Protein TIC110, chloroplastic

Arabidopsis / Rice Reference Genes and Papers

Download references for this gene

Arabidopsis

Reference gene ID	Possible function	Papers / DOI
`At1g06950`	Involved in protein precursor import into chloroplasts.	atTic110 functions as a scaffold for coordinating the stromal events of protein import into chloroplasts.2003 · DOI: 10.1074/jbc.m306367200 In vivo studies on the roles of Tic110, Tic40 and Hsp93 during chloroplast protein import.2005 · DOI: 10.1111/j.1365-313x.2004.02307.x Arabidopsis tic110 is essential for the assembly and function of the protein import machinery of plastids.2005 · DOI: 10.1105/tpc.105.030700

Rice

No hit for this species in the current source table.

Functional annotation source

View annotation sources

Functional annotation source: OH1004 · LXL04_036629 · GCA_047496595.1_OSU_TarKok_2.0.

GO annotations (OH1004 source)

GO:0009658 chloroplast organization Biological Process

GO:0045037 protein import into chloroplast stroma Biological Process

GO:0005576 extracellular region Cellular Component

GO:0009507 chloroplast Cellular Component

GO:0009536 plastid Cellular Component

GO:0009706 chloroplast inner membrane Cellular Component

GO:0009941 chloroplast envelope Cellular Component

GO:0031897 Tic complex Cellular Component

GO:0061927 TOC-TIC supercomplex I Cellular Component

KEGG gene cross-reference

ath:AT1G06950

These KEGG gene identifiers are linked through homologous proteins; they do not establish pathway function for this gene.

Open Annotation Module

Gene expression

View expression in different studies, tissues and treatments. Results are presented separately by study and measurement unit.

View expression for this gene

Data sources and gene correspondence

Expression data come from public transcriptome studies. Reference genomes, sample metadata and measurement units are shown with the results. Ambiguous cross-reference correspondences do not select an expression record automatically; missing values do not mean zero expression.

Subcellular Localization Top 5

Computational predictions or homology annotations below do not replace localization experiments.

Plastid0.956

Rank 1 · LXL04_036629 · OH-1004

Mitochondrion0.042

Rank 2 · LXL04_036629 · OH-1004

Nucleus0.032

Rank 3 · LXL04_036629 · OH-1004

Cytoplasm0.029

Rank 4 · LXL04_036629 · OH-1004

Peroxisome0.022

Rank 5 · LXL04_036629 · OH-1004

LocPro · Direct prediction · Computational prediction, not experimental localization

Open Subcellular Module

Predicted Functional Domains

Domain results are from Pfam-A/HMMER; positions are amino-acid coordinates on the protein sequence.

PF16940.11Tic11080-656 aa

Gene ID	Domain ID	Domain Name	Start aa	End aa	E-value	Score
LXL04_036629	`PF16940.11`	Tic110	80	656	1e-279	929.7

Arabidopsis / Rice Protein Homology

Only Arabidopsis and rice are shown. Swiss-Prot entries are reviewed; TrEMBL entries are supplementary sequence candidates. Similarity is not experimental validation.

Download current result

Protein	Organism	Description	Identity	Database	Confidence
`Q8LPR9`	Arabidopsis thaliana	Protein TIC110, chloroplastic	63.803%	Swiss-Prot	strong database homology

JBrowse

View in Genome Browser

Gene Card