LXL04_036243 | RubberDandelionOmics

Gene overview

LXL04_036243

Reference: OH-1004 Chr: Chr08 Coordinates: 38442032-38445624 Strand: + Type: protein_coding

cDNA / CDS / Protein Sequences

Available sequence downloads CDS FASTA Protein FASTA cDNA FASTA

cDNA

849 bp · LXL04_036243|LXL04_036243|OH1004|cDNA

ATGCCCACTAAAGTTTCCATCATGTGtagttcttcatcatcttcctcaAGTGGAGATCGTGGTGGTGGCGACGACAGTGGTGGTGGAGCTTGTGGAGGAGAAGAGAGACGGAGGAAGACGATGGGTCGGGGGAGGATTGAGATAAAAAAGATTGAGAATGTCAGTAGTCGACAGGTAACGTTTTCAAAACGTCGTGCTGGACTTATGAAGAAAGCTAAAGAGTTGGCAATTCTGTGTGATGCGGAGGTGGGCGTTATCAT...

CDS

Download CDS FASTA

849 bp · LXL04_036243|LXL04_036243|OH1004|CDS

ATGCCCACTAAAGTTTCCATCATGTGTAGTTCTTCATCATCTTCCTCAAGTGGAGATCGTGGTGGTGGCGACGACAGTGGTGGTGGAGCTTGTGGAGGAGAAGAGAGACGGAGGAAGACGATGGGTCGGGGGAGGATTGAGATAAAAAAGATTGAGAATGTCAGTAGTCGACAGGTAACGTTTTCAAAACGTCGTGCTGGACTTATGAAGAAAGCTAAAGAGTTGGCAATTCTGTGTGATGCGGAGGTGGGCGTTATCAT...

Protein

Download Protein FASTA

282 aa · LXL04_036243|LXL04_036243|OH1004|PROTEIN

MPTKVSIMCSSSSSSSSGDRGGGDDSGGGACGGEERRRKTMGRGRIEIKKIENVSSRQVTFSKRRAGLMKKAKELAILCDAEVGVIIFSSTGKLYEFASSRLQNIISRYERNLDSSDKPGLVVETRQEVDPEVKALKAEIMKLRKGQRLMMGKELEGLSYKELEHLERQLHDGMLAVKNQKDMALLEEIEQTKLREQRTMQENEALKKQVKFLTLPNKLKIVDHLNKSSEIHLSGRNIPFITPNPLGCLKRDNGDIGISL...

Flanking Sequence Download

Sequence orientation and download details

Upstream/downstream are capped at 10000 bp per side. Negative-strand genes are reverse-complemented so the final FASTA follows transcriptional 5′→3′ orientation.

ID Mapping

Input ID	`LXL04_036243`
TK1151 ID	TkA04G061390
OH-1004 ID	LXL04_036243
Relationship / confidence	Multi Source To Oh1004 / Complex relationship
Protein identity (%)	96.100
Protein coverage (%)	TK1151 100.000 / OH-1004 100.000 Coverage and evidence Coverage is the aligned span of the best-scoring HSP divided by representative protein length. A homolog match does not establish functional validation.
Source version	OH-1004 / GCA_047496595.1_OSU_TarKok_2.0

Open Full ID Mapping

SNP / Indel variants and carrier samplesCRA009020 · OH-1004

Expand to load variant records for this gene.

Basic Information and Functional Annotation

Gene ID LXL04_036243

Location Chr08:38442032-38445624 (+)

Description Similar to AGL15: Agamous-like MADS-box protein AGL15

Arabidopsis / Rice Reference Genes and Papers

Download references for this gene

Arabidopsis

Reference gene ID	Possible function	Papers / DOI
`At3g57390`	Probable transcription factor involved in the negative regulation of flowering, probably through the photoperiodic pathway.	The MADS domain factors AGL15 and AGL18 act redundantly as repressors of the floral transition in Arabidopsis.2007 · DOI: 10.1111/j.1365-313x.2007.03105.x MADS-complexes regulate transcriptome dynamics during pollen maturation.2007 · DOI: 10.1186/gb-2007-8-11-r249
`At5g13790`	Transcription factor involved in the negative regulation of flowering, probably through the photoperiodic pathway.	The MADS-domain protein AGAMOUS-like 15 accumulates in embryonic tissues with diverse origins.1999 · DOI: 10.1104/pp.120.1.121 The embryo MADS domain factor AGL15 acts postembryonically. Inhibition of perianth senescence and abscission via constitutive expression.2000 · DOI: 10.1105/tpc.12.2.183 Effect of regulated overexpression of the MADS domain factor AGL15 on flower senescence and fruit maturation.2002 · DOI: 10.1104/pp.004721 Binding site selection for the plant MADS domain protein AGL15: an in vitro and in vivo study.2003 · DOI: 10.1074/jbc.m212976200 The embryo MADS domain protein AGAMOUS-Like 15 directly regulates expression of a gene encoding an enzyme involved in gibberellin metabolism.2004 · DOI: 10.1105/tpc.021261 Control of expression and autoregulation of AGL15, a member of the MADS-box family.2005 · DOI: 10.1111/j.1365-313x.2004.02320.x The MADS domain factors AGL15 and AGL18 act redundantly as repressors of the floral transition in Arabidopsis.2007 · DOI: 10.1111/j.1365-313x.2007.03105.x The MADS-domain transcriptional regulator AGAMOUS-LIKE15 promotes somatic embryo development in Arabidopsis and soybean.2008 · DOI: 10.1104/pp.108.115832 Arabidopsis cold shock domain proteins: relationships to floral and silique development.2009 · DOI: 10.1093/jxb/ern351 Global identification of targets of the Arabidopsis MADS domain protein AGAMOUS-Like15.2009 · DOI: 10.1105/tpc.109.068890 The MADS domain protein AGL15 localizes to the nucleus during early stages of seed development.1996 · DOI: 10.1105/tpc.8.11.1977
`At3g57230`	Probable transcription factor involved in the regulation of flowering time in long-day photoperiod.	MicroRNA-mediated regulation of stomatal development in Arabidopsis.2007 · DOI: 10.1105/tpc.107.050377 miR824-Regulated AGAMOUS-LIKE16 Contributes to Flowering Time Repression in Arabidopsis.2014 · DOI: 10.1105/tpc.114.124685

Rice

Reference gene ID	Possible function	Papers / DOI
`Os02g0579600`	Probable transcription factor.	No verified direct reference in this release

Functional annotation source

View annotation sources

Functional annotation source: OH1004 · LXL04_036243 · GCA_047496595.1_OSU_TarKok_2.0.

GO annotations (OH1004 source)

GO:0006351 DNA-templated transcription Biological Process

GO:0006357 regulation of transcription by RNA polymerase II Biological Process

GO:0009555 pollen development Biological Process

GO:0009793 embryo development ending in seed dormancy Biological Process

GO:0009908 flower development Biological Process

GO:0009910 negative regulation of flower development Biological Process

GO:0010047 fruit dehiscence Biological Process

GO:0010227 floral organ abscission Biological Process

GO:0010262 somatic embryogenesis Biological Process

GO:0010440 stomatal lineage progression Biological Process

GO:0010629 negative regulation of gene expression Biological Process

GO:0045487 gibberellin catabolic process Biological Process

KEGG gene cross-reference

ath:AT3G57230

ath:AT3G57390

ath:AT5G13790

dosa:Os02g0579600

These KEGG gene identifiers are linked through homologous proteins; they do not establish pathway function for this gene.

Open Annotation Module

Gene expression

View expression in different studies, tissues and treatments. Results are presented separately by study and measurement unit.

View expression for this gene

Data sources and gene correspondence

Expression data come from public transcriptome studies. Reference genomes, sample metadata and measurement units are shown with the results. Ambiguous cross-reference correspondences do not select an expression record automatically; missing values do not mean zero expression.

Subcellular Localization Top 5

Computational predictions or homology annotations below do not replace localization experiments.

Nucleus0.967

Rank 1 · LXL04_036243 · OH-1004

Cytoplasm0.088

Rank 2 · LXL04_036243 · OH-1004

Cell membrane0.027

Rank 3 · LXL04_036243 · OH-1004

Endoplasmic reticulum0.014

Rank 4 · LXL04_036243 · OH-1004

Plastid0.011

Rank 5 · LXL04_036243 · OH-1004

LocPro · Direct prediction · Computational prediction, not experimental localization

Open Subcellular Module

Predicted Functional Domains

Domain results are from Pfam-A/HMMER; positions are amino-acid coordinates on the protein sequence.

PF00319.24SRF-TF50-97 aa

PF01486.23K-box126-210 aa

Gene ID	Domain ID	Domain Name	Start aa	End aa	E-value	Score
LXL04_036243	`PF00319.24`	SRF-TF	50	97	9.9e-27	92.9
LXL04_036243	`PF01486.23`	K-box	126	210	1.9e-17	63.9

Arabidopsis / Rice Protein Homology

Only Arabidopsis and rice are shown. Swiss-Prot entries are reviewed; TrEMBL entries are supplementary sequence candidates. Similarity is not experimental validation.

Download current result

Protein	Organism	Description	Identity	Database	Confidence
`Q9M2K8`	Arabidopsis thaliana	Agamous-like MADS-box protein AGL18	42.339%	Swiss-Prot	moderate database homology
`Q38847`	Arabidopsis thaliana	Agamous-like MADS-box protein AGL15	41.277%	Swiss-Prot	moderate database homology
`A2RVQ5`	Arabidopsis thaliana	Agamous-like MADS-box protein AGL16	42.678%	Swiss-Prot	moderate database homology
`Q6EP49`	Oryza sativa subsp. japonica	MADS-box transcription factor 27	38.710%	Swiss-Prot	moderate database homology

JBrowse

View in Genome Browser

Gene Card