LXL04_035356 | RubberDandelionOmics

Gene overview

LXL04_035356

Reference: OH-1004 Chr: Chr08 Coordinates: 20955496-20958275 Strand: - Type: protein_coding

cDNA / CDS / Protein Sequences

Available sequence downloads CDS FASTA Protein FASTA cDNA FASTA

cDNA

1446 bp · LXL04_035356|LXL04_035356|OH1004|cDNA

ATGGGTTATCTCGACGGATGGATTTTGGAGCGATGGGTAGCGATGAAAGAATCTGTAGCGATGAATGTTGCGATCTGTATCGAAAAGACGAAGAGGATCAATTTTGACTTTGAATTTAATTCTGTTATTTTTCTTAAAAATACTAATTTTACAGGACGCGGCTCAGGACACACCTCTCCTACTAtttctcctctctctctctctctctctctatctctctctctctctctctctctctctctctctagaaCACACAGACA...

CDS

Download CDS FASTA

1446 bp · LXL04_035356|LXL04_035356|OH1004|CDS

ATGGGTTATCTCGACGGATGGATTTTGGAGCGATGGGTAGCGATGAAAGAATCTGTAGCGATGAATGTTGCGATCTGTATCGAAAAGACGAAGAGGATCAATTTTGACTTTGAATTTAATTCTGTTATTTTTCTTAAAAATACTAATTTTACAGGACGCGGCTCAGGACACACCTCTCCTACTATTTCTCCTCTCTCTCTCTCTCTCTCTCTATCTCTCTCTCTCTCTCTCTCTCTCTCTCTCTCTAGAACACACAGACA...

Protein

Download Protein FASTA

481 aa · LXL04_035356|LXL04_035356|OH1004|PROTEIN

MGYLDGWILERWVAMKESVAMNVAICIEKTKRINFDFEFNSVIFLKNTNFTGRGSGHTSPTISPLSLSLSLSLSLSLSLSLSRTHRHTPNSPNQTPIVKIPATKQRMPLCDVGKYQSGGDAVLYNGIKIFYRTYGAGPVKVLMIIGLAATHDSWNPQIQGLVGTVKPNDDDHRSTNERGIEVCAIDNRGVGRSSIPTKRSEYTTRIMAKDAIAVMDHLGWKKAHVFGHSMGGMIASKLAAVFPDRIQSLALLNVTGGGYQ...

Flanking Sequence Download

Sequence orientation and download details

Upstream/downstream are capped at 10000 bp per side. Negative-strand genes are reverse-complemented so the final FASTA follows transcriptional 5′→3′ orientation.

ID Mapping

Input ID	`LXL04_035356`
Source version	OH-1004 / GCA_047496595.1_OSU_TarKok_2.0

Open Full ID Mapping

SNP / Indel variants and carrier samplesCRA009020 · OH-1004

Expand to load variant records for this gene.

Basic Information and Functional Annotation

Gene ID	`LXL04_035356`
Location	Chr08:20955496-20958275 (-)
Description	Similar to rutD: Putative aminoacrylate hydrolase RutD (Azorhizobium caulinodans (strain ATCC 43989 / DSM 5975 / JCM 20966 / NBRC 14845 / NCIMB 13405 / ORS 571)
Arabidopsis / Rice Reference Genes and Papers	Download references for this gene Arabidopsis No hit for this species in the current source table. Rice No hit for this species in the current source table.
Functional annotation source	View annotation sources Functional annotation source: OH1004 · `LXL04_035356` · GCA_047496595.1_OSU_TarKok_2.0.
GO annotations (OH1004 source)	GO:0006212 uracil catabolic process Biological Process GO:0009636 response to toxic substance Biological Process GO:0019740 nitrogen utilization Biological Process GO:0042632 cholesterol homeostasis Biological Process GO:0046464 acylglycerol catabolic process Biological Process GO:0046839 phospholipid dephosphorylation Biological Process GO:0097176 epoxide metabolic process Biological Process GO:0005777 peroxisome Cellular Component GO:0016020 membrane Cellular Component GO:0000287 magnesium ion binding Molecular Function GO:0004301 epoxide hydrolase activity Molecular Function GO:0016811 hydrolase activity, acting on carbon-nitrogen (but not peptide) bonds, in linear amides Molecular Function
KEGG gene cross-reference	ag:BAA14412 azc:AZC_2496 cak:Caul_3981 mch:Mchl_2054 ssc:414425 These KEGG gene identifiers are linked through homologous proteins; they do not establish pathway function for this gene.

Open Annotation Module

Gene expression

View expression in different studies, tissues and treatments. Results are presented separately by study and measurement unit.

View expression for this gene

Data sources and gene correspondence

Expression data come from public transcriptome studies. Reference genomes, sample metadata and measurement units are shown with the results. Ambiguous cross-reference correspondences do not select an expression record automatically; missing values do not mean zero expression.

Subcellular Localization Top 5

Computational predictions or homology annotations below do not replace localization experiments.

Cytoplasm0.298

Rank 1 · LXL04_035356 · OH-1004

Nucleus0.196

Rank 2 · LXL04_035356 · OH-1004

Endoplasmic reticulum0.182

Rank 3 · LXL04_035356 · OH-1004

Mitochondrion0.132

Rank 4 · LXL04_035356 · OH-1004

Cell membrane0.102

Rank 5 · LXL04_035356 · OH-1004

LocPro · Direct prediction · Computational prediction, not experimental localization

Open Subcellular Module

Predicted Functional Domains

Domain results are from Pfam-A/HMMER; positions are amino-acid coordinates on the protein sequence.

PF00561.27Abhydrolase_1141-400 aa

PF12697.14Abhydrolase_6149-407 aa

PF12146.16Hydrolase_4176-255 aa

Gene ID	Domain ID	Domain Name	Start aa	End aa	E-value	Score
LXL04_035356	`PF00561.27`	Abhydrolase_1	141	400	3.1e-25	90.0
LXL04_035356	`PF12697.14`	Abhydrolase_6	149	407	2.2e-11	45.5
LXL04_035356	`PF12146.16`	Hydrolase_4	176	255	9.8e-12	45.4

Arabidopsis / Rice Protein Homology

Only Arabidopsis and rice are shown. Swiss-Prot entries are reviewed; TrEMBL entries are supplementary sequence candidates. Similarity is not experimental validation.

Download current result

No result was found for this query.

JBrowse

View in Genome Browser

Gene Card