LXL04_035352 | RubberDandelionOmics

Gene overview

LXL04_035352

Reference: OH-1004 Chr: Chr08 Coordinates: 20893825-20897256 Strand: + Type: protein_coding

cDNA / CDS / Protein Sequences

Available sequence downloads CDS FASTA Protein FASTA cDNA FASTA

cDNA

1932 bp · LXL04_035352|LXL04_035352|OH1004|cDNA

ATGGAGACCTTGCTCCAGTCTTGCCCCATTTTCACAGCCAAGGCTTCGGTGAGATCGTCTGTTGATAGGCAATTGGCCTTCTCTTCTTTTGCCATTAATAAACAGAGGAATTGTAATGTGAAGTTAAGGGCGATAAGCCGGAGCTCTCAAGATGGATCTTCTTCTATTGAAGATGTAAGGAAGGATGGCATGTTATTGGGTGCTGATAAAGACGAATCTGGTTCGGTCGTTGGATTTCATCTGATTCCTCAATCTGTCAT...

CDS

Download CDS FASTA

1932 bp · LXL04_035352|LXL04_035352|OH1004|CDS

ATGGAGACCTTGCTCCAGTCTTGCCCCATTTTCACAGCCAAGGCTTCGGTGAGATCGTCTGTTGATAGGCAATTGGCCTTCTCTTCTTTTGCCATTAATAAACAGAGGAATTGTAATGTGAAGTTAAGGGCGATAAGCCGGAGCTCTCAAGATGGATCTTCTTCTATTGAAGATGTAAGGAAGGATGGCATGTTATTGGGTGCTGATAAAGACGAATCTGGTTCGGTCGTTGGATTTCATCTGATTCCTCAATCTGTCAT...

Protein

Download Protein FASTA

643 aa · LXL04_035352|LXL04_035352|OH1004|PROTEIN

METLLQSCPIFTAKASVRSSVDRQLAFSSFAINKQRNCNVKLRAISRSSQDGSSSIEDVRKDGMLLGADKDESGSVVGFHLIPQSVIDDDTHLILELPGEIEISNSHDTTSNGKEELITDDDSVKTTSAEVTYNIVFVTSEAAPYSKTGGLGDVCGSLPIALAERGHRVMVVSPRYLNGGPADKKFAGAIDLDCRIKVSCSGGVQEVAFFHEYRAGVDWVFVDHPSYHRPGNPYGDAYGAFGDNQFRFTLLCHAACEAPL...

Flanking Sequence Download

Sequence orientation and download details

Upstream/downstream are capped at 10000 bp per side. Negative-strand genes are reverse-complemented so the final FASTA follows transcriptional 5′→3′ orientation.

ID Mapping

Input ID	`LXL04_035352`
Source version	OH-1004 / GCA_047496595.1_OSU_TarKok_2.0

Open Full ID Mapping

SNP / Indel variants and carrier samplesCRA009020 · OH-1004

Expand to load variant records for this gene.

Basic Information and Functional Annotation

Gene ID LXL04_035352

Location Chr08:20893825-20897256 (+)

Description Similar to Soluble starch synthase 1, chloroplastic/amyloplastic

Arabidopsis / Rice Reference Genes and Papers

Download references for this gene

Arabidopsis

Reference gene ID	Possible function	Papers / DOI
`At5g24300`	Involved in the synthesis of short glycan chains within amylopectin in leaves.	No verified direct reference in this release

Rice

Reference gene ID	Possible function	Papers / DOI
`Os06g0160700`	Involved in starch synthesis in endosperm amyloplasts.	No verified direct reference in this release
`UniProt: A2Y9M4`	Soluble starch synthase 1, chloroplastic/amyloplastic.	No verified direct reference in this release

Functional annotation source

View annotation sources

Functional annotation source: OH1004 · LXL04_035352 · GCA_047496595.1_OSU_TarKok_2.0.

GO annotations (OH1004 source)

GO:0009960 endosperm development Biological Process

GO:0010021 amylopectin biosynthetic process Biological Process

GO:0019252 starch biosynthetic process Biological Process

GO:0009501 amyloplast Cellular Component

GO:0009507 chloroplast Cellular Component

GO:0009536 plastid Cellular Component

GO:0009570 chloroplast stroma Cellular Component

GO:0004373 alpha-1,4-glucan glucosyltransferase (UDP-glucose donor) activity Molecular Function

GO:0009011 alpha-1,4-glucan glucosyltransferase (ADP-glucose donor) activity Molecular Function

KEGG gene cross-reference

ath:AT5G24300

sot:102600045

These KEGG gene identifiers are linked through homologous proteins; they do not establish pathway function for this gene.

Open Annotation Module

Gene expression

View expression in different studies, tissues and treatments. Results are presented separately by study and measurement unit.

View expression for this gene

Data sources and gene correspondence

Expression data come from public transcriptome studies. Reference genomes, sample metadata and measurement units are shown with the results. Ambiguous cross-reference correspondences do not select an expression record automatically; missing values do not mean zero expression.

Subcellular Localization Top 5

Computational predictions or homology annotations below do not replace localization experiments.

Plastid0.907

Rank 1 · LXL04_035352 · OH-1004

Cytoplasm0.053

Rank 2 · LXL04_035352 · OH-1004

Peroxisome0.042

Rank 3 · LXL04_035352 · OH-1004

Mitochondrion0.041

Rank 4 · LXL04_035352 · OH-1004

Cell membrane0.038

Rank 5 · LXL04_035352 · OH-1004

LocPro · Direct prediction · Computational prediction, not experimental localization

Open Subcellular Module

Predicted Functional Domains

Domain results are from Pfam-A/HMMER; positions are amino-acid coordinates on the protein sequence.

PF08323.18Glyco_transf_5134-392 aa

PF00534.27Glycos_transf_1448-598 aa

PF13692.13Glyco_trans_1_4450-563 aa

Gene ID	Domain ID	Domain Name	Start aa	End aa	E-value	Score
LXL04_035352	`PF08323.18`	Glyco_transf_5	134	392	1.3e-64	218.9
LXL04_035352	`PF00534.27`	Glycos_transf_1	448	598	2.7e-15	57.0
LXL04_035352	`PF13692.13`	Glyco_trans_1_4	450	563	1.6e-13	51.8

Arabidopsis / Rice Protein Homology

Only Arabidopsis and rice are shown. Swiss-Prot entries are reviewed; TrEMBL entries are supplementary sequence candidates. Similarity is not experimental validation.

Download current result

Protein	Organism	Description	Identity	Database	Confidence
`Q9FNF2`	Arabidopsis thaliana	Starch synthase 1, chloroplastic/amyloplastic	70.728%	Swiss-Prot	strong database homology
`Q0DEC8`	Oryza sativa subsp. japonica	Soluble starch synthase 1, chloroplastic/amyloplastic	73.129%	Swiss-Prot	strong database homology
`A2Y9M4`	Oryza sativa subsp. indica	Soluble starch synthase 1, chloroplastic/amyloplastic	72.937%	Swiss-Prot	strong database homology

JBrowse

View in Genome Browser

Gene Card