LXL04_035063 | RubberDandelionOmics

Gene overview

LXL04_035063

Reference: OH-1004 Chr: Chr08 Coordinates: 13229316-13232030 Strand: + Type: protein_coding

cDNA / CDS / Protein Sequences

Available sequence downloads CDS FASTA Protein FASTA cDNA FASTA

cDNA

1502 bp · LXL04_035063|LXL04_035063|OH1004|cDNA

ATGGCACAAGATGGTGAACGTGGATCCACTGAAGCTGGTACTGTCTCTCCTTATGATGAAGCAATGGACGCCTTGTCATCTCTAATTACTCAGAAAACTCGTGCTGATAAGACCAATAGCGGACATAGATTTGAGCTACTCTTCGATTACGTTAAGATTCTGGATTTGGAAGAGTCAATTTCAAAGATGAAAATCATCCATGTCGCAGGCACTAAAGGAAAGGGTTCAACATGCACATTTACTGAAGCAATACTACGCAA...

CDS

Download CDS FASTA

1452 bp · LXL04_035063|LXL04_035063|OH1004|CDS

ATGGCACAAGATGGTGAACGTGGATCCACTGAAGCTGGTACTGTCTCTCCTTATGATGAAGCAATGGACGCCTTGTCATCTCTAATTACTCAGAAAACTCGTGCTGATAAGACCAATAGCGGACATAGATTTGAGCTACTCTTCGATTACGTTAAGATTCTGGATTTGGAAGAGTCAATTTCAAAGATGAAAATCATCCATGTCGCAGGCACTAAAGGAAAGGGTTCAACATGCACATTTACTGAAGCAATACTACGCAA...

Protein

Download Protein FASTA

483 aa · LXL04_035063|LXL04_035063|OH1004|PROTEIN

MAQDGERGSTEAGTVSPYDEAMDALSSLITQKTRADKTNSGHRFELLFDYVKILDLEESISKMKIIHVAGTKGKGSTCTFTEAILRNCGFRTGLFTSPHLIDVRERFRLDGVDISEEKFLAYFWWCWDRLKAQCNDDIDIPMPNLFRFLALLAFKIFAAEQVDVAIMEVGLGGKFDATNVVQNPVVCGISSLGYDHTEILGDTLAAIAGEKAGIFKKGVPAFTVPQPEEAMQVLKEKASQLDVCLEVANPLDIKLLKGLA...

Flanking Sequence Download

Sequence orientation and download details

Upstream/downstream are capped at 10000 bp per side. Negative-strand genes are reverse-complemented so the final FASTA follows transcriptional 5′→3′ orientation.

ID Mapping

Input ID	`LXL04_035063`
TK1151 ID	TkA04G171910
OH-1004 ID	LXL04_035063
Relationship / confidence	Rbh Below Probable Coverage Or Synteny Threshold / Review
Protein identity (%)	99.400
Protein coverage (%)	TK1151 82.368 / OH-1004 64.803 Coverage and evidence Coverage is the aligned span of the best-scoring HSP divided by representative protein length. A homolog match does not establish functional validation.
Source version	OH-1004 / GCA_047496595.1_OSU_TarKok_2.0

Open Full ID Mapping

SNP / Indel variants and carrier samplesCRA009020 · OH-1004

Expand to load variant records for this gene.

Basic Information and Functional Annotation

Gene ID LXL04_035063

Location Chr08:13229316-13232030 (+)

Description Similar to FPGS1: Folylpolyglutamate synthase

Arabidopsis / Rice Reference Genes and Papers

Download references for this gene

Arabidopsis

Reference gene ID	Possible function	Papers / DOI
`At5g05980`	Catalyzes conversion of folates to polyglutamate derivatives allowing concentration of folate compounds in the cell and the intracellular retention of these cofactors, which are important substrates for most of the folate-dependent enzymes that are involved in one-carbon transfer reactions involved in purine, pyrimidine and amino acid synthesis.	Functional analysis of folate polyglutamylation and its essential role in plant metabolism and development.2010 · DOI: 10.1111/j.1365-313x.2010.04336.x The folylpolyglutamate synthetase plastidial isoform is required for postembryonic root development in Arabidopsis.2011 · DOI: 10.1104/pp.110.168278
`At3g55630`	Catalyzes conversion of folates to polyglutamate derivatives allowing concentration of folate compounds in the cell and the intracellular retention of these cofactors, which are important substrates for most of the folate-dependent enzymes that are involved in one-carbon transfer reactions involved in purine, pyrimidine and amino acid synthesis.	No verified direct reference in this release
`At3g10160`	Catalyzes conversion of folates to polyglutamate derivatives allowing concentration of folate compounds in the cell and the intracellular retention of these cofactors, which are important substrates for most of the folate-dependent enzymes that are involved in one-carbon transfer reactions involved in purine, pyrimidine and amino acid synthesis.	No verified direct reference in this release

Rice

No hit for this species in the current source table.

Functional annotation source

View annotation sources

Functional annotation source: OH1004 · LXL04_035063 · GCA_047496595.1_OSU_TarKok_2.0.

GO annotations (OH1004 source)

GO:0006536 glutamate metabolic process Biological Process

GO:0006730 one-carbon metabolic process Biological Process

GO:0006760 folic acid-containing compound metabolic process Biological Process

GO:0008283 cell population proliferation Biological Process

GO:0009809 lignin biosynthetic process Biological Process

GO:0009853 photorespiration Biological Process

GO:0010449 root meristem growth Biological Process

GO:0046901 tetrahydrofolylpolyglutamate biosynthetic process Biological Process

GO:0048364 root development Biological Process

GO:0048767 root hair elongation Biological Process

GO:0090351 seedling development Biological Process

GO:1904961 quiescent center organization Biological Process

KEGG gene cross-reference

ath:AT3G10160

ath:AT3G55630

ath:AT5G05980

bta:505809

mmu:14287

These KEGG gene identifiers are linked through homologous proteins; they do not establish pathway function for this gene.

Open Annotation Module

Gene expression

View expression in different studies, tissues and treatments. Results are presented separately by study and measurement unit.

View expression for this gene

Data sources and gene correspondence

Expression data come from public transcriptome studies. Reference genomes, sample metadata and measurement units are shown with the results. Ambiguous cross-reference correspondences do not select an expression record automatically; missing values do not mean zero expression.

Subcellular Localization Top 5

Computational predictions or homology annotations below do not replace localization experiments.

Cytoplasm0.509

Rank 1 · LXL04_035063 · OH-1004

Nucleus0.206

Rank 2 · LXL04_035063 · OH-1004

Mitochondrion0.185

Rank 3 · LXL04_035063 · OH-1004

Peroxisome0.120

Rank 4 · LXL04_035063 · OH-1004

Plastid0.085

Rank 5 · LXL04_035063 · OH-1004

LocPro · Direct prediction · Computational prediction, not experimental localization

Open Subcellular Module

Predicted Functional Domains

No result was found for this query.

Arabidopsis / Rice Protein Homology

Only Arabidopsis and rice are shown. Swiss-Prot entries are reviewed; TrEMBL entries are supplementary sequence candidates. Similarity is not experimental validation.

Download current result

Protein	Organism	Description	Identity	Database	Confidence
`F4K2A1`	Arabidopsis thaliana	Folylpolyglutamate synthase	66.300%	Swiss-Prot	strong database homology
`Q8W035`	Arabidopsis thaliana	Folylpolyglutamate synthase	60.460%	Swiss-Prot	strong database homology
`F4J2K2`	Arabidopsis thaliana	Folylpolyglutamate synthase	56.290%	Swiss-Prot	strong database homology

JBrowse

View in Genome Browser

Gene Card