LXL04_034081 | RubberDandelionOmics

Gene overview

LXL04_034081

Reference: OH-1004 Chr: Chr07 Coordinates: 80196757-80198267 Strand: - Type: protein_coding

cDNA / CDS / Protein Sequences

Available sequence downloads CDS FASTA Protein FASTA cDNA FASTA

cDNA

556 bp · LXL04_034081|LXL04_034081|OH1004|cDNA

TGAGATTGTTGTTTCTGAGAAAGTATCGAGTGTATCAAGGAGTGTGTTTGAGGTGGACTGTGTGGCTTTGTGGGGATTTACTTCGATTTGTGGAAGGAGACCTGAGATGGAAGACGCGGTTGCCACTGTGCCAAGATTCTTGAAGATTCCTGTTCAGATGTTGACCGGTGACAAGATGACCAAAAGTCTCAGCCACTTGACCGCCCATTTCTTTGGGGTTTATGATGGCCATGGTGGCTCTCAGGTTGCTAATTACTGTA...

CDS

Download CDS FASTA

489 bp · LXL04_034081|LXL04_034081|OH1004|CDS

TTGTGGGGATTTACTTCGATTTGTGGAAGGAGACCTGAGATGGAAGACGCGGTTGCCACTGTGCCAAGATTCTTGAAGATTCCTGTTCAGATGTTGACCGGTGACAAGATGACCAAAAGTCTCAGCCACTTGACCGCCCATTTCTTTGGGGTTTATGATGGCCATGGTGGCTCTCAGGTTGCTAATTACTGTAGTGGCCGAGTTCATACTGCATTACAAGAGGAATTAGAACCACTTATGGCGGGTGGTGGCGGTGATGA...

Protein

Download Protein FASTA

162 aa · LXL04_034081|LXL04_034081|OH1004|PROTEIN

MWGFTSICGRRPEMEDAVATVPRFLKIPVQMLTGDKMTKSLSHLTAHFFGVYDGHGGSQVANYCSGRVHTALQEELEPLMAGGGGDENSCQDLWKKAFIRCFLRVDHEIGGKQGNLEIIAPETVGSTVPVKRKLGTDYNGVSSNDWGNIGYTTIANSPIPGN

Flanking Sequence Download

Sequence orientation and download details

Upstream/downstream are capped at 10000 bp per side. Negative-strand genes are reverse-complemented so the final FASTA follows transcriptional 5′→3′ orientation.

ID Mapping

Input ID	`LXL04_034081`
TK1151 ID	TkA07G377920
OH-1004 ID	LXL04_034081
Relationship / confidence	Sequence Supported Annotation Or Model Conflict / Review
Protein identity (%)	96.300
Protein coverage (%)	TK1151 57.447 / OH-1004 100.000 Coverage and evidence Coverage is the aligned span of the best-scoring HSP divided by representative protein length. A homolog match does not establish functional validation.
Source version	OH-1004 / GCA_047496595.1_OSU_TarKok_2.0

Open Full ID Mapping

SNP / Indel variants and carrier samplesCRA009020 · OH-1004

Expand to load variant records for this gene.

Basic Information and Functional Annotation

Gene ID LXL04_034081

Location Chr07:80196757-80198267 (-)

Description Similar to HAB2: Protein phosphatase 2C 7

Arabidopsis / Rice Reference Genes and Papers

Download references for this gene

Arabidopsis

Reference gene ID	Possible function	Papers / DOI
`At1g17550`	Key component and repressor of the abscisic acid (ABA) signaling pathway that regulates numerous ABA responses, such as stomatal closure, seed germination and inhibition of vegetative growth.	No verified direct reference in this release
`At1g72770`	Key component and repressor of the abscisic acid (ABA) signaling pathway that regulates numerous ABA responses, such as stomatal closure, seed germination and inhibition of vegetative growth.	Gain-of-function and loss-of-function phenotypes of the protein phosphatase 2C HAB1 reveal its role as a negative regulator of abscisic acid signalling.2004 · DOI: 10.1046/j.1365-313x.2003.01966.x Enhancement of abscisic acid sensitivity and reduction of water consumption in Arabidopsis by combined inactivation of the protein phosphatases type 2C ABI1 and HAB1.2006 · DOI: 10.1104/pp.106.081018 A hypermorphic mutation in the protein phosphatase 2C HAB1 strongly affects ABA signaling in Arabidopsis.2006 · DOI: 10.1016/j.febslet.2006.07.047
`At5g57050`	Repressor of the abscisic acid (ABA) signaling pathway that regulates numerous ABA responses, such as stomatal closure, osmotic water permeability of the plasma membrane (Pos), high light stress, response to glucose, seed germination and inhibition of vegetative growth.	Arabidopsis abi1-1 and abi2-1 phosphatase mutations reduce abscisic acid-induced cytoplasmic calcium rises in guard cells.1999 · DOI: 10.1105/tpc.11.9.1785 The genes ABI1 and ABI2 are involved in abscisic acid- and drought-inducible expression of the Daucus carota L. Dc3 promoter in guard cells of transgenic Arabidopsis thaliana (L.) Heynh.2000 · DOI: 10.1007/s004250050692 Analysis of Arabidopsis glucose insensitive mutants, gin5 and gin6, reveals a central role of the plant hormone ABA in the regulation of plant vegetative development by sugar.2000 · PMID: 10950871 The ABI1 and ABI2 protein phosphatases 2C act in a negative feedback regulatory loop of the abscisic acid signalling pathway.2001 · DOI: 10.1046/j.1365-313x.2001.00965.x Abscisic acid activation of plasma membrane Ca(2+) channels in guard cells requires cytosolic NAD(P)H and is differentially disrupted upstream and downstream of reactive oxygen species production in abi1-1 and abi2-1 protein phosphatase 2C mutants.2001 · DOI: 10.1105/tpc.010210 The role of ABA and the transpiration stream in the regulation of the osmotic water permeability of leaf cells.2001 · DOI: 10.1073/pnas.231471998 Hypersensitivity of abscisic acid-induced cytosolic calcium increases in the Arabidopsis farnesyltransferase mutant era1-2.2002 · DOI: 10.1105/tpc.010448 A calcium sensor and its interacting protein kinase are global regulators of abscisic acid signaling in Arabidopsis.2002 · DOI: 10.1016/s1534-5807(02)00229-0 Maternal Effects Govern Variable Dominance of Two Abscisic Acid Response Mutations in Arabidopsis thaliana.1994 · DOI: 10.1104/pp.105.4.1203 Hydrotropism in abscisic acid, wavy, and gravitropic mutants of Arabidopsis thaliana.2002 · DOI: 10.1007/s00425-002-0840-3 Control of Ascorbate Peroxidase 2 expression by hydrogen peroxide and leaf water status during excess light stress reveals a functional organisation of Arabidopsis leaves.2003 · DOI: 10.1046/j.1365-313x.2003.01656.x Synthesis of the Arabidopsis bifunctional lysine-ketoglutarate reductase/saccharopine dehydrogenase enzyme of lysine catabolism is concertedly regulated by metabolic and stress-associated signals.2003 · DOI: 10.1104/pp.103.026294 Regulation of the ABA-sensitive Arabidopsis potassium channel gene GORK in response to water stress.2003 · DOI: 10.1016/s0014-5793(03)01118-9 The ABI2-dependent abscisic acid signalling controls HrpN-induced drought tolerance in Arabidopsis.2005 · DOI: 10.1007/s00425-004-1444-x Heat stress phenotypes of Arabidopsis mutants implicate multiple signaling pathways in the acquisition of thermotolerance.2005 · DOI: 10.1104/pp.105.062257 Role of abscisic acid (ABA) and Arabidopsis thaliana ABA-insensitive loci in low water potential-induced ABA and proline accumulation.2006 · DOI: 10.1093/jxb/erj026 Fibrillin expression is regulated by abscisic acid response regulators and is involved in abscisic acid-mediated photoprotection.2006 · DOI: 10.1073/pnas.0501720103 Interaction between sugar and abscisic acid signalling during early seedling development in Arabidopsis.2008 · DOI: 10.1007/s11103-008-9308-6 A plasma membrane receptor kinase, GHR1, mediates abscisic acid- and hydrogen peroxide-regulated stomatal movement in Arabidopsis.2012 · DOI: 10.1105/tpc.112.100107 Abscisic acid induces the alcohol dehydrogenase gene in Arabidopsis.1996 · DOI: 10.1104/pp.111.2.381 Differential abscisic acid regulation of guard cell slow anion channels in Arabidopsis wild-type and abi1 and abi2 mutants.1997 · DOI: 10.1105/tpc.9.3.409 Abscisic acid-independent and abscisic acid-dependent regulation of proline biosynthesis following cold and osmotic stresses in Arabidopsis thaliana.1997 · DOI: 10.1007/s004380050397 The Arabidopsis ABSCISIC ACID-INSENSITIVE2 (ABI2) and ABI1 genes encode homologous protein phosphatases 2C involved in abscisic acid signal transduction.1997 · DOI: 10.1105/tpc.9.5.759 Convergence of the abscisic acid, CO2, and extracellular calcium signal transduction pathways in stomatal guard cells.1997 · DOI: 10.1104/pp.114.4.1557

Rice

Reference gene ID	Possible function	Papers / DOI
`Os01g0583100`	Probable protein phosphatase that may function in abscisic acid (ABA) signaling.	No verified direct reference in this release
`Os05g0592800`	Protein phosphatase that acts as a negative regulator of abscisic acid (ABA) signaling.	ABA Regulates Subcellular Redistribution of OsABI-LIKE2, a Negative Regulator in ABA Signaling, to Control Root Architecture and Drought Resistance in Oryza sativa.2015 · DOI: 10.1093/pcp/pcv154

Functional annotation source

View annotation sources

Functional annotation source: OH1004 · LXL04_034081 · GCA_047496595.1_OSU_TarKok_2.0.

GO annotations (OH1004 source)

GO:0006470 protein dephosphorylation Biological Process

GO:0006970 response to osmotic stress Biological Process

GO:0009408 response to heat Biological Process

GO:0009414 response to water deprivation Biological Process

GO:0009737 response to abscisic acid Biological Process

GO:0009738 abscisic acid-activated signaling pathway Biological Process

GO:0009788 negative regulation of abscisic acid-activated signaling pathway Biological Process

GO:0010205 photoinhibition Biological Process

GO:0048364 root development Biological Process

GO:1902456 regulation of stomatal opening Biological Process

GO:1902531 regulation of intracellular signal transduction Biological Process

GO:0005634 nucleus Cellular Component

KEGG gene cross-reference

ath:AT1G17550

ath:AT1G72770

ath:AT5G57050

dosa:Os01g0583100

dosa:Os05g0592800

osa:4339797

These KEGG gene identifiers are linked through homologous proteins; they do not establish pathway function for this gene.

Open Annotation Module

Gene expression

View expression in different studies, tissues and treatments. Results are presented separately by study and measurement unit.

View expression for this gene

Data sources and gene correspondence

Expression data come from public transcriptome studies. Reference genomes, sample metadata and measurement units are shown with the results. Ambiguous cross-reference correspondences do not select an expression record automatically; missing values do not mean zero expression.

Subcellular Localization Top 5

Computational predictions or homology annotations below do not replace localization experiments.

Nucleus0.398

Rank 1 · LXL04_034081 · OH-1004

Cytoplasm0.386

Rank 2 · LXL04_034081 · OH-1004

Cell membrane0.150

Rank 3 · LXL04_034081 · OH-1004

Endoplasmic reticulum0.108

Rank 4 · LXL04_034081 · OH-1004

Mitochondrion0.078

Rank 5 · LXL04_034081 · OH-1004

LocPro · Direct prediction · Computational prediction, not experimental localization

Open Subcellular Module

Predicted Functional Domains

Domain results are from Pfam-A/HMMER; positions are amino-acid coordinates on the protein sequence.

PF00481.27PP2C31-76 aa

Gene ID	Domain ID	Domain Name	Start aa	End aa	E-value	Score
LXL04_034081	`PF00481.27`	PP2C	31	76	4.4e-06	27.3

Arabidopsis / Rice Protein Homology

Only Arabidopsis and rice are shown. Swiss-Prot entries are reviewed; TrEMBL entries are supplementary sequence candidates. Similarity is not experimental validation.

Download current result

Protein	Organism	Description	Identity	Database	Confidence
`Q9LNP9`	Arabidopsis thaliana	Protein phosphatase 2C 7	50.685%	Swiss-Prot	strong database homology
`Q9CAJ0`	Arabidopsis thaliana	Protein phosphatase 2C 16	51.724%	Swiss-Prot	strong database homology
`O04719`	Arabidopsis thaliana	Protein phosphatase 2C 77	52.632%	Swiss-Prot	strong database homology
`Q0JLP9`	Oryza sativa subsp. japonica	Probable protein phosphatase 2C 6	54.015%	Swiss-Prot	strong database homology
`Q6L4R7`	Oryza sativa subsp. japonica	Protein phosphatase 2C 53	50.725%	Swiss-Prot	strong database homology

JBrowse

View in Genome Browser

Gene Card