LXL04_033273 | RubberDandelionOmics

Gene overview

LXL04_033273

Reference: OH-1004 Chr: Chr07 Coordinates: 40017150-40018367 Strand: + Type: protein_coding

cDNA / CDS / Protein Sequences

Available sequence downloads CDS FASTA Protein FASTA cDNA FASTA

cDNA

620 bp · LXL04_033273|LXL04_033273|OH1004|cDNA

ATGAAGGAGGTCAAAGTCAAACAAAGCAGTACATCTGGAAAGAGCAATATCAGATCTATAAATAGCATAATTCTCAGGTTTCCTCATTTCAGAGAGGGATTGCAAGAGGTTAGGGATGTTTTTCGACAGTACGATACTGATGCTAATGGAACTATCAACCGCGAGGAGCTAAAAAAATGCTTACAAGAATTACAATTGGACTGCACTGAGCAAGAAATTGATGATCTTTTTGAGTCTTGCGATTTGACTGGGAAAAAAGG...

CDS

Download CDS FASTA

579 bp · LXL04_033273|LXL04_033273|OH1004|CDS

ATGAAGGAGGTCAAAGTCAAACAAAGCAGTACATCTGGAAAGAGCAATATCAGATCTATAAATAGCATAATTCTCAGGTTTCCTCATTTCAGAGAGGGATTGCAAGAGGTTAGGGATGTTTTTCGACAGTACGATACTGATGCTAATGGAACTATCAACCGCGAGGAGCTAAAAAAATGCTTACAAGAATTACAATTGGACTGCACTGAGCAAGAAATTGATGATCTTTTTGAGTCTTGCGATTTGACTGGGAAAAAAGG...

Protein

Download Protein FASTA

192 aa · LXL04_033273|LXL04_033273|OH1004|PROTEIN

MKEVKVKQSSTSGKSNIRSINSIILRFPHFREGLQEVRDVFRQYDTDANGTINREELKKCLQELQLDCTEQEIDDLFESCDLTGKKGMKFNEFVVVLCLVYLLVDTSSSHHTATKIGSPVLKATFDTMIEAFLYLDKNGDGKLNKKDITKAMNDHFHLEKSPIHITATRFKEMDWNKDGKVGFREFLFSLIR

Flanking Sequence Download

Sequence orientation and download details

Upstream/downstream are capped at 10000 bp per side. Negative-strand genes are reverse-complemented so the final FASTA follows transcriptional 5′→3′ orientation.

ID Mapping

Input ID	`LXL04_033273`
Source version	OH-1004 / GCA_047496595.1_OSU_TarKok_2.0

Open Full ID Mapping

SNP / Indel variants and carrier samplesCRA009020 · OH-1004

Expand to load variant records for this gene.

Basic Information and Functional Annotation

Gene ID LXL04_033273

Location Chr07:40017150-40018367 (+)

Description No functional description available

Arabidopsis / Rice Reference Genes and Papers

Download references for this gene

Arabidopsis

Reference gene ID	Possible function	Papers / DOI
`At3g24110`	Potential calcium sensor.	No verified direct reference in this release
`At4g26470`	Potential calcium sensor.	No verified direct reference in this release
`At2g41100`	Potential calcium sensor that binds calcium in vitro.	No verified direct reference in this release

Rice

Reference gene ID	Possible function	Papers / DOI
`Os03g0688300`	May play a role in signal transduction pathways that involve calcium as a second messenger (By similarity).	A rice calcium-dependent protein kinase OsCPK9 positively regulates drought stress tolerance and spikelet fertility.2014 · DOI: 10.1186/1471-2229-14-133

Functional annotation source

View annotation sources

Functional annotation source: OH1004 · LXL04_033273 · GCA_047496595.1_OSU_TarKok_2.0.

GO annotations (OH1004 source)

GO:0006970 response to osmotic stress Biological Process

GO:0009612 response to mechanical stimulus Biological Process

GO:0009646 response to absence of light Biological Process

GO:0009652 thigmotropism Biological Process

GO:0010152 pollen maturation Biological Process

GO:0035556 intracellular signal transduction Biological Process

GO:0051301 cell division Biological Process

GO:0071456 cellular response to hypoxia Biological Process

GO:1902584 positive regulation of response to water deprivation Biological Process

GO:0000325 plant-type vacuole Cellular Component

GO:0005634 nucleus Cellular Component

GO:0005737 cytoplasm Cellular Component

KEGG gene cross-reference

ath:AT2G41100

ath:AT3G24110

ath:AT4G26470

dosa:Os03g0688300

These KEGG gene identifiers are linked through homologous proteins; they do not establish pathway function for this gene.

Open Annotation Module

Gene expression

View expression in different studies, tissues and treatments. Results are presented separately by study and measurement unit.

View expression for this gene

Data sources and gene correspondence

Expression data come from public transcriptome studies. Reference genomes, sample metadata and measurement units are shown with the results. Ambiguous cross-reference correspondences do not select an expression record automatically; missing values do not mean zero expression.

Subcellular Localization Top 5

Computational predictions or homology annotations below do not replace localization experiments.

Cytoplasm0.571

Rank 1 · LXL04_033273 · OH-1004

Cell membrane0.256

Rank 2 · LXL04_033273 · OH-1004

Nucleus0.236

Rank 3 · LXL04_033273 · OH-1004

Mitochondrion0.068

Rank 4 · LXL04_033273 · OH-1004

Endoplasmic reticulum0.060

Rank 5 · LXL04_033273 · OH-1004

LocPro · Direct prediction · Computational prediction, not experimental localization

Open Subcellular Module

Predicted Functional Domains

Domain results are from Pfam-A/HMMER; positions are amino-acid coordinates on the protein sequence.

PF13499.13EF-hand_736-94 aa

PF00036.39EF-hand_136-63 aa

PF13405.13EF-hand_636-64 aa

PF13202.13EF-hand_538-61 aa

PF10591.16SPARC_Ca_bdg40-94 aa

PF13499.13EF-hand_7126-187 aa

PF13405.13EF-hand_6128-153 aa

PF00036.39EF-hand_1129-153 aa

Gene ID	Domain ID	Domain Name	Start aa	End aa	E-value	Score
LXL04_033273	`PF13499.13`	EF-hand_7	36	94	1.8e-20	73.8
LXL04_033273	`PF00036.39`	EF-hand_1	36	63	2.3e-18	65.0
LXL04_033273	`PF13405.13`	EF-hand_6	36	64	9.8e-17	59.8
LXL04_033273	`PF13202.13`	EF-hand_5	38	61	4.4e-15	55.1
LXL04_033273	`PF10591.16`	SPARC_Ca_bdg	40	94	1e-07	33.0
LXL04_033273	`PF13499.13`	EF-hand_7	126	187	1.8e-20	73.8
LXL04_033273	`PF13405.13`	EF-hand_6	128	153	9.8e-17	59.8
LXL04_033273	`PF00036.39`	EF-hand_1	129	153	2.3e-18	65.0

Arabidopsis / Rice Protein Homology

Only Arabidopsis and rice are shown. Swiss-Prot entries are reviewed; TrEMBL entries are supplementary sequence candidates. Similarity is not experimental validation.

Download current result

Protein	Organism	Description	Identity	Database	Confidence
`Q9LRN6`	Arabidopsis thaliana	Probable calcium-binding protein CML22	49.462%	Swiss-Prot	moderate database homology
`Q52K82`	Arabidopsis thaliana	Probable calcium-binding protein CML21	39.791%	Swiss-Prot	moderate database homology
`P25071`	Arabidopsis thaliana	Calmodulin-like protein 12	26.875%	Swiss-Prot	weak database homology
`Q6AVI8`	Oryza sativa subsp. japonica	Calcium-dependent protein kinase 9	28.481%	Swiss-Prot	weak database homology

JBrowse

View in Genome Browser

Gene Card