LXL04_032850 | RubberDandelionOmics

Gene overview

LXL04_032850

Reference: OH-1004 Chr: Chr07 Coordinates: 30465676-30470182 Strand: + Type: protein_coding

cDNA / CDS / Protein Sequences

Available sequence downloads CDS FASTA Protein FASTA cDNA FASTA

cDNA

909 bp · LXL04_032850|LXL04_032850|OH1004|cDNA

ATGGCTACCCTACTCCGTCGATTTGTAAGGACCGAAGAGGAACCAGCGACGGCGCGAAACCTGCGAAGCATCACCGGTCTTCATCGCCTTCAGTTCCGACGGTACCCTGCGAAACCTGCGAAGTCTTCTGATTCAGCCTTCATTTCCGACGGTACCCTGCGATCCAGATCGACATCATCTACCGACTATAATCAAATCAGACATTGCCCGTATATTATTGAGGCTATTACATCATTGGCTGAGTTAGGTGTTCAAGCAAA...

CDS

Download CDS FASTA

909 bp · LXL04_032850|LXL04_032850|OH1004|CDS

ATGGCTACCCTACTCCGTCGATTTGTAAGGACCGAAGAGGAACCAGCGACGGCGCGAAACCTGCGAAGCATCACCGGTCTTCATCGCCTTCAGTTCCGACGGTACCCTGCGAAACCTGCGAAGTCTTCTGATTCAGCCTTCATTTCCGACGGTACCCTGCGATCCAGATCGACATCATCTACCGACTATAATCAAATCAGACATTGCCCGTATATTATTGAGGCTATTACATCATTGGCTGAGTTAGGTGTTCAAGCAAA...

Protein

Download Protein FASTA

302 aa · LXL04_032850|LXL04_032850|OH1004|PROTEIN

MATLLRRFVRTEEEPATARNLRSITGLHRLQFRRYPAKPAKSSDSAFISDGTLRSRSTSSTDYNQIRHCPYIIEAITSLAELGVQAKDIFSLLPQTPSRSGRPPFDQFESGRWLQRYVEAQCCIASNDYKGWSTFVNIRLFSLDNYSLDYSNMQFNMIQGKGEQLCVPPTQEDEDDDDGSKVDPIVSKANRELLRTHIFPRTPKPLTFSKNRLWGDKNRSITSPVANNRELLRTHIFPRTPKPLTFSKNRLWGDKNRSIT...

Flanking Sequence Download

Sequence orientation and download details

Upstream/downstream are capped at 10000 bp per side. Negative-strand genes are reverse-complemented so the final FASTA follows transcriptional 5′→3′ orientation.

ID Mapping

Input ID	`LXL04_032850`
TK1151 ID	TkA08G209250
OH-1004 ID	LXL04_032850
Relationship / confidence	Rbh Below Probable Coverage Or Synteny Threshold / Review
Protein identity (%)	61.200
Protein coverage (%)	TK1151 100.000 / OH-1004 56.291 Coverage and evidence Coverage is the aligned span of the best-scoring HSP divided by representative protein length. A homolog match does not establish functional validation.
Source version	OH-1004 / GCA_047496595.1_OSU_TarKok_2.0

Open Full ID Mapping

SNP / Indel variants and carrier samplesCRA009020 · OH-1004

Expand to load variant records for this gene.

Basic Information and Functional Annotation

Gene ID LXL04_032850

Location Chr07:30465676-30470182 (+)

Description Similar to APC7: Anaphase-promoting complex subunit 7

Arabidopsis / Rice Reference Genes and Papers

Download references for this gene

Arabidopsis

Reference gene ID	Possible function	Papers / DOI
`At2g39090`	Component of the anaphase promoting complex/cyclosome (APC/C), a cell cycle-regulated E3 ubiquitin-protein ligase complex that controls progression through mitosis and the G1 phase of the cell cycle.	No verified direct reference in this release

Rice

No hit for this species in the current source table.

Functional annotation source

View annotation sources

Functional annotation source: OH1004 · LXL04_032850 · GCA_047496595.1_OSU_TarKok_2.0.

GO annotations (OH1004 source)

GO:0016567 protein ubiquitination Biological Process

GO:0045842 positive regulation of mitotic metaphase/anaphase transition Biological Process

GO:0051301 cell division Biological Process

GO:0005634 nucleus Cellular Component

GO:0005680 anaphase-promoting complex Cellular Component

GO:0140767 enzyme-substrate adaptor activity Molecular Function

KEGG gene cross-reference

ath:AT2G39090

These KEGG gene identifiers are linked through homologous proteins; they do not establish pathway function for this gene.

Open Annotation Module

Gene expression

View expression in different studies, tissues and treatments. Results are presented separately by study and measurement unit.

View expression for this gene

Data sources and gene correspondence

Expression data come from public transcriptome studies. Reference genomes, sample metadata and measurement units are shown with the results. Ambiguous cross-reference correspondences do not select an expression record automatically; missing values do not mean zero expression.

Subcellular Localization Top 5

Computational predictions or homology annotations below do not replace localization experiments.

Cytoplasm0.372

Rank 1 · LXL04_032850 · OH-1004

Nucleus0.342

Rank 2 · LXL04_032850 · OH-1004

Mitochondrion0.214

Rank 3 · LXL04_032850 · OH-1004

Cell membrane0.119

Rank 4 · LXL04_032850 · OH-1004

Endoplasmic reticulum0.078

Rank 5 · LXL04_032850 · OH-1004

LocPro · Direct prediction · Computational prediction, not experimental localization

Open Subcellular Module

Predicted Functional Domains

No result was found for this query.

Arabidopsis / Rice Protein Homology

Only Arabidopsis and rice are shown. Swiss-Prot entries are reviewed; TrEMBL entries are supplementary sequence candidates. Similarity is not experimental validation.

Download current result

Protein	Organism	Description	Identity	Database	Confidence
`Q8VY89`	Arabidopsis thaliana	Anaphase-promoting complex subunit 7	60.606%	Swiss-Prot	weak database homology

JBrowse

View in Genome Browser

Gene Card