LXL04_032821 | RubberDandelionOmics

Gene overview

LXL04_032821

Reference: OH-1004 Chr: Chr07 Coordinates: 29875711-29877233 Strand: + Type: protein_coding

cDNA / CDS / Protein Sequences

Available sequence downloads CDS FASTA Protein FASTA cDNA FASTA

cDNA

1041 bp · LXL04_032821|LXL04_032821|OH1004|cDNA

ATGCAATCGAAGATAAAGTCATTCTTTAGACCTTGTTTTTCTTCTACATCACGAAGCCAAGCCCTAGATCCACCTCTTCCCCTTTTGGATAATTCCTCCGACGAAGAAGACTTCACCAGAGAACCCGAAATTGCCATTGTATACACGCGACGAGCTCCAAACACAGATAGTGTCGTTAAGAACGTACTCGATTCTGGATCACAATCGGCGGTATCAAATTCCAAAAAAGTTTCAAACAAAAAAAGAAAGTATGCACAGTT...

CDS

Download CDS FASTA

1041 bp · LXL04_032821|LXL04_032821|OH1004|CDS

ATGCAATCGAAGATAAAGTCATTCTTTAGACCTTGTTTTTCTTCTACATCACGAAGCCAAGCCCTAGATCCACCTCTTCCCCTTTTGGATAATTCCTCCGACGAAGAAGACTTCACCAGAGAACCCGAAATTGCCATTGTATACACGCGACGAGCTCCAAACACAGATAGTGTCGTTAAGAACGTACTCGATTCTGGATCACAATCGGCGGTATCAAATTCCAAAAAAGTTTCAAACAAAAAAAGAAAGTATGCACAGTT...

Protein

Download Protein FASTA

346 aa · LXL04_032821|LXL04_032821|OH1004|PROTEIN

MQSKIKSFFRPCFSSTSRSQALDPPLPLLDNSSDEEDFTREPEIAIVYTRRAPNTDSVVKNVLDSGSQSAVSNSKKVSNKKRKYAQFHLDLGQSDFLLHTCKTCGFKFAPGDEEDTKVHKEFHKSYTHGIQFKGWRNERVIDSHSLEHGRVILVLNDDPPAHIKKVEEVIKMMEMELGDGWIFHKHCKVYLYISSQRVAGCLVAEPINKAYRLVSNSDQKDDVTTTVTEVKKSTPTTLQFGSISLQREIIKKVKHKKELN...

Flanking Sequence Download

Sequence orientation and download details

Upstream/downstream are capped at 10000 bp per side. Negative-strand genes are reverse-complemented so the final FASTA follows transcriptional 5′→3′ orientation.

ID Mapping

Input ID	`LXL04_032821`
Source version	OH-1004 / GCA_047496595.1_OSU_TarKok_2.0

Open Full ID Mapping

SNP / Indel variants and carrier samplesCRA009020 · OH-1004

Expand to load variant records for this gene.

Basic Information and Functional Annotation

Gene ID LXL04_032821

Location Chr07:29875711-29877233 (+)

Description Similar to CTF7: Protein CHROMOSOME TRANSMISSION FIDELITY 7

Arabidopsis / Rice Reference Genes and Papers

Download references for this gene

Arabidopsis

Reference gene ID	Possible function	Papers / DOI
`At4g31400`	Acetyltransferase required for the establishment of sister chromatid cohesion.	Proper levels of the Arabidopsis cohesion establishment factor CTF7 are essential for embryo and megagametophyte, but not endosperm, development.2010 · DOI: 10.1104/pp.110.157560 Arabidopsis CHROMOSOME TRANSMISSION FIDELITY 7 (AtCTF7/ECO1) is required for DNA repair, mitosis and meiosis.2013 · DOI: 10.1111/tpj.12261 The Opposing Actions of Arabidopsis CHROMOSOME TRANSMISSION FIDELITY7 and WINGS APART-LIKE1 and 2 Differ in Mitotic and Meiotic Cells.2016 · DOI: 10.1105/tpc.15.00781

Rice

No hit for this species in the current source table.

Functional annotation source

View annotation sources

Functional annotation source: OH1004 · LXL04_032821 · GCA_047496595.1_OSU_TarKok_2.0.

GO annotations (OH1004 source)

GO:0000070 mitotic sister chromatid segregation Biological Process

GO:0000278 mitotic cell cycle Biological Process

GO:0000724 double-strand break repair via homologous recombination Biological Process

GO:0006275 regulation of DNA replication Biological Process

GO:0006281 DNA repair Biological Process

GO:0006302 double-strand break repair Biological Process

GO:0007059 chromosome segregation Biological Process

GO:0007062 sister chromatid cohesion Biological Process

GO:0007064 mitotic sister chromatid cohesion Biological Process

GO:0009553 embryo sac development Biological Process

GO:0009793 embryo development ending in seed dormancy Biological Process

GO:0018394 peptidyl-lysine acetylation Biological Process

KEGG gene cross-reference

ath:AT4G31400

dre:445395

hsa:114799

hsa:157570

mmu:71988

These KEGG gene identifiers are linked through homologous proteins; they do not establish pathway function for this gene.

Open Annotation Module

Gene expression

View expression in different studies, tissues and treatments. Results are presented separately by study and measurement unit.

View expression for this gene

Data sources and gene correspondence

Expression data come from public transcriptome studies. Reference genomes, sample metadata and measurement units are shown with the results. Ambiguous cross-reference correspondences do not select an expression record automatically; missing values do not mean zero expression.

Subcellular Localization Top 5

Computational predictions or homology annotations below do not replace localization experiments.

Nucleus0.898

Rank 1 · LXL04_032821 · OH-1004

Cytoplasm0.196

Rank 2 · LXL04_032821 · OH-1004

Mitochondrion0.030

Rank 3 · LXL04_032821 · OH-1004

Cell membrane0.024

Rank 4 · LXL04_032821 · OH-1004

Endoplasmic reticulum0.012

Rank 5 · LXL04_032821 · OH-1004

LocPro · Direct prediction · Computational prediction, not experimental localization

Open Subcellular Module

Predicted Functional Domains

Domain results are from Pfam-A/HMMER; positions are amino-acid coordinates on the protein sequence.

PF13878.13zf-C2H2_386-124 aa

PF13880.13Acetyltransf_13275-342 aa

Gene ID	Domain ID	Domain Name	Start aa	End aa	E-value	Score
LXL04_032821	`PF13878.13`	zf-C2H2_3	86	124	5.4e-15	55.6
LXL04_032821	`PF13880.13`	Acetyltransf_13	275	342	1.3e-27	96.1

Arabidopsis / Rice Protein Homology

Only Arabidopsis and rice are shown. Swiss-Prot entries are reviewed; TrEMBL entries are supplementary sequence candidates. Similarity is not experimental validation.

Download current result

Protein	Organism	Description	Identity	Database	Confidence
`A7UL74`	Arabidopsis thaliana	Protein CHROMOSOME TRANSMISSION FIDELITY 7	47.989%	Swiss-Prot	moderate database homology

JBrowse

View in Genome Browser

Gene Card