LXL04_032600 | RubberDandelionOmics

Gene overview

LXL04_032600

Reference: OH-1004 Chr: Chr07 Coordinates: 26101877-26104076 Strand: + Type: protein_coding

cDNA / CDS / Protein Sequences

Available sequence downloads CDS FASTA Protein FASTA cDNA FASTA

cDNA

1017 bp · LXL04_032600|LXL04_032600|OH1004|cDNA

ATGGCGAGTGGTGCCAGAGCTCAAGTGAACAAGTCGCATAAGACGCGATTTGCGTCGAAATCCTCTCGCAAAATCGAGGATGGAGATATAATTTGCTTTCAGAAATTATCTGAAGCTCGGGCTGTGGATAAATACAGATACCCTGACGTTCCTTCATTTCTAGAATATGTGAAAAACCATCAGATTGTTCATTTTCGGTCTTTAGATAGACCCAAGGAGGATGATTTCTGTCTTGAATTGTCAGTTTCCCGTtcttattt...

CDS

Download CDS FASTA

1017 bp · LXL04_032600|LXL04_032600|OH1004|CDS

ATGGCGAGTGGTGCCAGAGCTCAAGTGAACAAGTCGCATAAGACGCGATTTGCGTCGAAATCCTCTCGCAAAATCGAGGATGGAGATATAATTTGCTTTCAGAAATTATCTGAAGCTCGGGCTGTGGATAAATACAGATACCCTGACGTTCCTTCATTTCTAGAATATGTGAAAAACCATCAGATTGTTCATTTTCGGTCTTTAGATAGACCCAAGGAGGATGATTTCTGTCTTGAATTGTCAGTTTCCCGTTCTTATTT...

Protein

Download Protein FASTA

338 aa · LXL04_032600|LXL04_032600|OH1004|PROTEIN

MASGARAQVNKSHKTRFASKSSRKIEDGDIICFQKLSEARAVDKYRYPDVPSFLEYVKNHQIVHFRSLDRPKEDDFCLELSVSRSYLIFMSKLHTYDDVTKRVAGQISVDDPSKIRLTPHNCYSQQPKPHPIKFRVAEHLLDMLVHYNQVSDILYYEVLDIPLPELQCLKTLKVAFHHSTKEEPVIHNIRLPKQSTVGDVLNEIKTKIFPLTDKIENINDQYWTLRAEEIPEEEKNLGPLDRLIHVYHFTKEAAQNQMQV...

Flanking Sequence Download

Sequence orientation and download details

Upstream/downstream are capped at 10000 bp per side. Negative-strand genes are reverse-complemented so the final FASTA follows transcriptional 5′→3′ orientation.

ID Mapping

Input ID	`LXL04_032600`
Source version	OH-1004 / GCA_047496595.1_OSU_TarKok_2.0

Open Full ID Mapping

SNP / Indel variants and carrier samplesCRA009020 · OH-1004

Expand to load variant records for this gene.

Basic Information and Functional Annotation

Gene ID LXL04_032600

Location Chr07:26101877-26104076 (+)

Description Similar to UBP13: Ubiquitin carboxyl-terminal hydrolase 13

Arabidopsis / Rice Reference Genes and Papers

Download references for this gene

Arabidopsis

Reference gene ID	Possible function	Papers / DOI
`At3g11910`	Recognizes and hydrolyzes the peptide bond at the C-terminal Gly of ubiquitin.	No verified direct reference in this release
`At5g06600`	Recognizes and hydrolyzes the peptide bond at the C-terminal Gly of ubiquitin.	No verified direct reference in this release

Rice

No hit for this species in the current source table.

Functional annotation source

View annotation sources

Functional annotation source: OH1004 · LXL04_032600 · GCA_047496595.1_OSU_TarKok_2.0.

GO annotations (OH1004 source)

GO:0000045 autophagosome assembly Biological Process

GO:0006283 transcription-coupled nucleotide-excision repair Biological Process

GO:0006307 DNA alkylation repair Biological Process

GO:0006508 proteolysis Biological Process

GO:0009867 jasmonic acid mediated signaling pathway Biological Process

GO:0010078 maintenance of root meristem identity Biological Process

GO:0010507 negative regulation of autophagy Biological Process

GO:0010508 positive regulation of autophagy Biological Process

GO:0010803 regulation of tumor necrosis factor-mediated signaling pathway Biological Process

GO:0016579 protein deubiquitination Biological Process

GO:0031647 regulation of protein stability Biological Process

GO:0031669 cellular response to nutrient levels Biological Process

KEGG gene cross-reference

ath:AT3G11910

ath:AT5G06600

mmu:252870

rno:360471

spo:2541131

These KEGG gene identifiers are linked through homologous proteins; they do not establish pathway function for this gene.

Open Annotation Module

Gene expression

View expression in different studies, tissues and treatments. Results are presented separately by study and measurement unit.

View expression for this gene

Data sources and gene correspondence

Expression data come from public transcriptome studies. Reference genomes, sample metadata and measurement units are shown with the results. Ambiguous cross-reference correspondences do not select an expression record automatically; missing values do not mean zero expression.

Subcellular Localization Top 5

Computational predictions or homology annotations below do not replace localization experiments.

Nucleus0.486

Rank 1 · LXL04_032600 · OH-1004

Cytoplasm0.367

Rank 2 · LXL04_032600 · OH-1004

Extracellular0.087

Rank 3 · LXL04_032600 · OH-1004

Cell membrane0.064

Rank 4 · LXL04_032600 · OH-1004

Mitochondrion0.062

Rank 5 · LXL04_032600 · OH-1004

LocPro · Direct prediction · Computational prediction, not experimental localization

Open Subcellular Module

Predicted Functional Domains

Domain results are from Pfam-A/HMMER; positions are amino-acid coordinates on the protein sequence.

PF12436.15USP7_ICP0_bdg21-144 aa

PF14533.13USP7_C2154-208 aa

PF14533.13USP7_C2207-298 aa

Gene ID	Domain ID	Domain Name	Start aa	End aa	E-value	Score
LXL04_032600	`PF12436.15`	USP7_ICP0_bdg	21	144	2.9e-26	93.1
LXL04_032600	`PF14533.13`	USP7_C2	154	208	8.7e-32	111.2
LXL04_032600	`PF14533.13`	USP7_C2	207	298	8.7e-32	111.2

Arabidopsis / Rice Protein Homology

Only Arabidopsis and rice are shown. Swiss-Prot entries are reviewed; TrEMBL entries are supplementary sequence candidates. Similarity is not experimental validation.

Download current result

Protein	Organism	Description	Identity	Database	Confidence
`Q84WU2`	Arabidopsis thaliana	Ubiquitin C-terminal hydrolase 13	64.560%	Swiss-Prot	strong database homology
`Q9FPT1`	Arabidopsis thaliana	Ubiquitin C-terminal hydrolase 12	64.187%	Swiss-Prot	strong database homology

JBrowse

View in Genome Browser

Gene Card