LXL04_032277 | RubberDandelionOmics

Gene overview

LXL04_032277

Reference: OH-1004 Chr: Chr07 Coordinates: 19869241-19874455 Strand: + Type: protein_coding

cDNA / CDS / Protein Sequences

Available sequence downloads CDS FASTA Protein FASTA cDNA FASTA

cDNA

4509 bp · LXL04_032277|LXL04_032277|OH1004|cDNA

ATGGctgagttttccggcgagataAACCACCGCGGCTGCAGCTTCACCGACCGGCCACACCACCCAACTCCACCTCCCTCAAACCAATCTCCGTCTCTCTCATTCTACAGCCCTCACACTTACCCATTCACATCTTCTCAAAGAACCCGTCACAACAACCACCGTGTTCCTCCCACCACCCCTTTCGCCTCCGACAATGACCGGTCATGGCAGGCTGAGATCTCATGGCAGTTCGAGCCCACAGGCTGGCAAGATAACCG...

CDS

Download CDS FASTA

4509 bp · LXL04_032277|LXL04_032277|OH1004|CDS

ATGGCTGAGTTTTCCGGCGAGATAAACCACCGCGGCTGCAGCTTCACCGACCGGCCACACCACCCAACTCCACCTCCCTCAAACCAATCTCCGTCTCTCTCATTCTACAGCCCTCACACTTACCCATTCACATCTTCTCAAAGAACCCGTCACAACAACCACCGTGTTCCTCCCACCACCCCTTTCGCCTCCGACAATGACCGGTCATGGCAGGCTGAGATCTCATGGCAGTTCGAGCCCACAGGCTGGCAAGATAACCG...

Protein

Download Protein FASTA

1502 aa · LXL04_032277|LXL04_032277|OH1004|PROTEIN

MAEFSGEINHRGCSFTDRPHHPTPPPSNQSPSLSFYSPHTYPFTSSQRTRHNNHRVPPTTPFASDNDRSWQAEISWQFEPTGWQDNRSSALALGAALSPWAGPILSHSPSPAPTPGSRVFRQSANDFYLSRTSGNDLNFRNFTNPHYEYSSILSPTPGRIELESFVGHHQPHSSSFNATGYNKSPTFAKMGRKSGGLVDDSDPFMSDDDIENYETGTNKQDPRWFSVSRAYVDHEMGRSYDGQNSPYGISLRSHDYHSNR...

Flanking Sequence Download

Sequence orientation and download details

Upstream/downstream are capped at 10000 bp per side. Negative-strand genes are reverse-complemented so the final FASTA follows transcriptional 5′→3′ orientation.

ID Mapping

Input ID	`LXL04_032277`
Source version	OH-1004 / GCA_047496595.1_OSU_TarKok_2.0

Open Full ID Mapping

SNP / Indel variants and carrier samplesCRA009020 · OH-1004

Expand to load variant records for this gene.

Basic Information and Functional Annotation

Gene ID LXL04_032277

Location Chr07:19869241-19874455 (+)

Description Similar to ABCB19: ABC transporter B family member 19

Arabidopsis / Rice Reference Genes and Papers

Download references for this gene

Arabidopsis

Reference gene ID	Possible function	Papers / DOI
`At3g28860`	May participate in brassinosteroid export and related signaling.	TWISTED DWARF1, a unique plasma membrane-anchored immunophilin-like protein, interacts with Arabidopsis multidrug resistance-like transporters AtPGP1 and AtPGP19.2003 · DOI: 10.1091/mbc.e02-10-0698 Connective auxin transport contributes to strigolactone-mediated shoot branching control independent of the transcription factor BRC1.2019 · DOI: 10.1371/journal.pgen.1008023 An ATP-Binding Cassette Transporter, ABCB19, Regulates Leaf Position and Morphology during Phototropin1-Mediated Blue Light Responses.2020 · DOI: 10.1104/pp.20.00223 Arabidopsis TWISTED DWARF1 regulates stamen elongation by differential activation of ABCB1,19-mediated auxin transport.2022 · DOI: 10.1093/jxb/erac185 Loss of Multiple ABCB Auxin Transporters Recapitulates the Major twisted dwarf 1 Phenotypes in Arabidopsis thaliana .2022 · DOI: 10.3389/fpls.2022.840260 Structure and function of the <i>Arabidopsis</i> ABC transporter ABCB19 in brassinosteroid export.2024 · DOI: 10.1126/science.adj4591 ABCB19 transporter: fostering brassinosteroid transport through membrane flexibility.2024 · DOI: 10.1016/j.tplants.2024.06.005 Structural insights into brassinosteroid export mediated by the Arabidopsis ABC transporter ABCB1.2025 · DOI: 10.1016/j.xplc.2024.101181 Quantitative analysis of the root posture of Arabidopsis thaliana mutants with wavy roots.2024 · DOI: 10.1017/qpb.2024.12
`At1g02520`	Involved in the regulation of auxin transport required for pistil elongation.	Loss of Multiple ABCB Auxin Transporters Recapitulates the Major twisted dwarf 1 Phenotypes in Arabidopsis thaliana .2022 · DOI: 10.3389/fpls.2022.840260
`At2g36910`	May participate in brassinosteroid export and related signaling.	Arabidopsis TWISTED DWARF1 regulates stamen elongation by differential activation of ABCB1,19-mediated auxin transport.2022 · DOI: 10.1093/jxb/erac185 Loss of Multiple ABCB Auxin Transporters Recapitulates the Major twisted dwarf 1 Phenotypes in Arabidopsis thaliana .2022 · DOI: 10.3389/fpls.2022.840260 Structure and function of the <i>Arabidopsis</i> ABC transporter ABCB19 in brassinosteroid export.2024 · DOI: 10.1126/science.adj4591 Structural insights into brassinosteroid export mediated by the Arabidopsis ABC transporter ABCB1.2025 · DOI: 10.1016/j.xplc.2024.101181
`At4g01830`	ABC transporter B family member 5.	No verified direct reference in this release
`At4g25960`	ABC transporter B family member 2.	No verified direct reference in this release

Rice

No hit for this species in the current source table.

Functional annotation source

View annotation sources

Functional annotation source: OH1004 · LXL04_032277 · GCA_047496595.1_OSU_TarKok_2.0.

GO annotations (OH1004 source)

GO:0008361 regulation of cell size Biological Process

GO:0009555 pollen development Biological Process

GO:0009624 response to nematode Biological Process

GO:0009637 response to blue light Biological Process

GO:0009639 response to red or far red light Biological Process

GO:0009640 photomorphogenesis Biological Process

GO:0009733 response to auxin Biological Process

GO:0009734 auxin-activated signaling pathway Biological Process

GO:0009741 response to brassinosteroid Biological Process

GO:0009742 brassinosteroid mediated signaling pathway Biological Process

GO:0009926 auxin polar transport Biological Process

GO:0009958 positive gravitropism Biological Process

KEGG gene cross-reference

ath:AT1G02520

ath:AT2G36910

ath:AT3G28860

ath:AT4G01830

These KEGG gene identifiers are linked through homologous proteins; they do not establish pathway function for this gene.

Open Annotation Module

Gene expression

View expression in different studies, tissues and treatments. Results are presented separately by study and measurement unit.

View expression for this gene

Data sources and gene correspondence

Expression data come from public transcriptome studies. Reference genomes, sample metadata and measurement units are shown with the results. Ambiguous cross-reference correspondences do not select an expression record automatically; missing values do not mean zero expression.

Subcellular Localization Top 5

Computational predictions or homology annotations below do not replace localization experiments.

Cell membrane0.460

Rank 1 · LXL04_032277 · OH-1004

Lysosome / Vacuole0.242

Rank 2 · LXL04_032277 · OH-1004

Endoplasmic reticulum0.133

Rank 3 · LXL04_032277 · OH-1004

Cytoplasm0.110

Rank 4 · LXL04_032277 · OH-1004

Golgi apparatus0.080

Rank 5 · LXL04_032277 · OH-1004

LocPro · Direct prediction · Computational prediction, not experimental localization

Open Subcellular Module

Predicted Functional Domains

Domain results are from Pfam-A/HMMER; positions are amino-acid coordinates on the protein sequence.

PF00664.29ABC_membrane303-572 aa

PF00005.34ABC_tran643-792 aa

PF02463.26SMC_N684-834 aa

PF00664.29ABC_membrane936-1207 aa

PF02463.26SMC_N1135-1464 aa

PF00005.34ABC_tran1275-1423 aa

PF09818.16ABC_ATPase1369-1448 aa

Gene ID	Domain ID	Domain Name	Start aa	End aa	E-value	Score
LXL04_032277	`PF00664.29`	ABC_membrane	303	572	6.3e-109	364.6
LXL04_032277	`PF00005.34`	ABC_tran	643	792	1.6e-61	207.6
LXL04_032277	`PF02463.26`	SMC_N	684	834	4.4e-17	63.0
LXL04_032277	`PF00664.29`	ABC_membrane	936	1207	6.3e-109	364.6
LXL04_032277	`PF02463.26`	SMC_N	1135	1464	4.4e-17	63.0
LXL04_032277	`PF00005.34`	ABC_tran	1275	1423	1.6e-61	207.6
LXL04_032277	`PF09818.16`	ABC_ATPase	1369	1448	1.5e-10	41.3

Arabidopsis / Rice Protein Homology

Only Arabidopsis and rice are shown. Swiss-Prot entries are reviewed; TrEMBL entries are supplementary sequence candidates. Similarity is not experimental validation.

Download current result

Protein	Organism	Description	Identity	Database	Confidence
`Q9LJX0`	Arabidopsis thaliana	ABC transporter B family member 19	42.407%	Swiss-Prot	moderate database homology
`Q9FWX7`	Arabidopsis thaliana	ABC transporter B family member 11	41.030%	Swiss-Prot	moderate database homology
`Q9ZR72`	Arabidopsis thaliana	ABC transporter B family member 1	40.192%	Swiss-Prot	moderate database homology
`Q9SYI3`	Arabidopsis thaliana	ABC transporter B family member 5	40.683%	Swiss-Prot	moderate database homology
`Q8LPK2`	Arabidopsis thaliana	ABC transporter B family member 2	40.292%	Swiss-Prot	moderate database homology

JBrowse

View in Genome Browser

Gene Card