LXL04_032045 | RubberDandelionOmics

Gene overview

LXL04_032045

Reference: OH-1004 Chr: Chr07 Coordinates: 15456148-15458702 Strand: - Type: protein_coding

cDNA / CDS / Protein Sequences

Available sequence downloads CDS FASTA Protein FASTA cDNA FASTA

cDNA

1785 bp · LXL04_032045|LXL04_032045|OH1004|cDNA

ATGGAAAAGTCAACCGTGGATATGGAGAATGAAGACGACTATGAAGAATACATCCCCATTGCCAAACGAAGAGCAATGGAAGCCCAAAAGATCCTCCAAAGAAAAGGCCAAGCTTCCACTCTCGAAGACGAAACCGAAAAATCCAAACAAGTGGAAACAAAACCGAGTCTACTCGTAAAAGCCTCCCAACTCAAACGCGATCAACCCGAAGTCACCCCAACAGAACACGCAGTCCaacaagaaaaagaaatgatGGAAAA...

CDS

Download CDS FASTA

1785 bp · LXL04_032045|LXL04_032045|OH1004|CDS

ATGGAAAAGTCAACCGTGGATATGGAGAATGAAGACGACTATGAAGAATACATCCCCATTGCCAAACGAAGAGCAATGGAAGCCCAAAAGATCCTCCAAAGAAAAGGCCAAGCTTCCACTCTCGAAGACGAAACCGAAAAATCCAAACAAGTGGAAACAAAACCGAGTCTACTCGTAAAAGCCTCCCAACTCAAACGCGATCAACCCGAAGTCACCCCAACAGAACACGCAGTCCAACAAGAAAAAGAAATGATGGAAAA...

Protein

Download Protein FASTA

594 aa · LXL04_032045|LXL04_032045|OH1004|PROTEIN

MEKSTVDMENEDDYEEYIPIAKRRAMEAQKILQRKGQASTLEDETEKSKQVETKPSLLVKASQLKRDQPEVTPTEHAVQQEKEMMENLSDRKTLMSVRELAKGITYSEPLPTGWKPPLPIRRMSQKASDGIRKQWHIIVDGDEIPPPIKNFKDMRFPDPVLKKLKEKGIVQPTPIQVQGLPVILSGRDMIGIAFTGSGKTLVFVLPLIMMALQEEIMMPIAQGEGPFGLVICPSRELARQTFEVVEEFLVPLREQGFPEI...

Flanking Sequence Download

Sequence orientation and download details

Upstream/downstream are capped at 10000 bp per side. Negative-strand genes are reverse-complemented so the final FASTA follows transcriptional 5′→3′ orientation.

ID Mapping

Input ID	`LXL04_032045`
Source version	OH-1004 / GCA_047496595.1_OSU_TarKok_2.0

Open Full ID Mapping

SNP / Indel variants and carrier samplesCRA009020 · OH-1004

Expand to load variant records for this gene.

Basic Information and Functional Annotation

Gene ID LXL04_032045

Location Chr07:15456148-15458702 (-)

Description Similar to RH35: DEAD-box ATP-dependent RNA helicase 35

Arabidopsis / Rice Reference Genes and Papers

Download references for this gene

Arabidopsis

Reference gene ID	Possible function	Papers / DOI
`At5g51280`	DEAD-box ATP-dependent RNA helicase 35.	No verified direct reference in this release
`At4g33370`	Putative DEAD-box ATP-dependent RNA helicase 43.	No verified direct reference in this release

Rice

Reference gene ID	Possible function	Papers / DOI
`Os02g0150100`	DEAD-box ATP-dependent RNA helicase 35A.	No verified direct reference in this release
`Os06g0697200`	DEAD-box ATP-dependent RNA helicase 35B.	No verified direct reference in this release

Functional annotation source

View annotation sources

Functional annotation source: OH1004 · LXL04_032045 · GCA_047496595.1_OSU_TarKok_2.0.

GO annotations (OH1004 source)

GO:0000398 mRNA splicing, via spliceosome Biological Process

GO:0008283 cell population proliferation Biological Process

GO:0030154 cell differentiation Biological Process

GO:0032481 positive regulation of type I interferon production Biological Process

GO:0035458 cellular response to interferon-beta Biological Process

GO:0045944 positive regulation of transcription by RNA polymerase II Biological Process

GO:0051607 defense response to virus Biological Process

GO:0140896 cGAS/STING signaling pathway Biological Process

GO:0005634 nucleus Cellular Component

GO:0005654 nucleoplasm Cellular Component

GO:0005681 spliceosomal complex Cellular Component

GO:0005737 cytoplasm Cellular Component

KEGG gene cross-reference

ath:AT4G33370

ath:AT5G51280

dosa:Os02g0150100

dosa:Os06g0697200

mmu:72935

These KEGG gene identifiers are linked through homologous proteins; they do not establish pathway function for this gene.

Open Annotation Module

Gene expression

View expression in different studies, tissues and treatments. Results are presented separately by study and measurement unit.

View expression for this gene

Data sources and gene correspondence

Expression data come from public transcriptome studies. Reference genomes, sample metadata and measurement units are shown with the results. Ambiguous cross-reference correspondences do not select an expression record automatically; missing values do not mean zero expression.

Subcellular Localization Top 5

Computational predictions or homology annotations below do not replace localization experiments.

Nucleus0.813

Rank 1 · LXL04_032045 · OH-1004

Cytoplasm0.250

Rank 2 · LXL04_032045 · OH-1004

Cell membrane0.032

Rank 3 · LXL04_032045 · OH-1004

Mitochondrion0.031

Rank 4 · LXL04_032045 · OH-1004

Endoplasmic reticulum0.027

Rank 5 · LXL04_032045 · OH-1004

LocPro · Direct prediction · Computational prediction, not experimental localization

Open Subcellular Module

Predicted Functional Domains

Domain results are from Pfam-A/HMMER; positions are amino-acid coordinates on the protein sequence.

PF00270.36DEAD173-352 aa

PF00271.38Helicase_C389-495 aa

Gene ID	Domain ID	Domain Name	Start aa	End aa	E-value	Score
LXL04_032045	`PF00270.36`	DEAD	173	352	2.2e-41	142.1
LXL04_032045	`PF00271.38`	Helicase_C	389	495	3e-32	111.8

Arabidopsis / Rice Protein Homology

Only Arabidopsis and rice are shown. Swiss-Prot entries are reviewed; TrEMBL entries are supplementary sequence candidates. Similarity is not experimental validation.

Download current result

Protein	Organism	Description	Identity	Database	Confidence
`Q9LU46`	Arabidopsis thaliana	DEAD-box ATP-dependent RNA helicase 35	84.327%	Swiss-Prot	strong database homology
`Q9SZB4`	Arabidopsis thaliana	Putative DEAD-box ATP-dependent RNA helicase 43	74.276%	Swiss-Prot	strong database homology
`Q0E3X4`	Oryza sativa subsp. japonica	DEAD-box ATP-dependent RNA helicase 35A	76.678%	Swiss-Prot	strong database homology
`Q5Z6G5`	Oryza sativa subsp. japonica	DEAD-box ATP-dependent RNA helicase 35B	73.289%	Swiss-Prot	strong database homology

JBrowse

View in Genome Browser

Gene Card