LXL04_030573 | RubberDandelionOmics

Gene overview

LXL04_030573

Reference: OH-1004 Chr: Chr06 Coordinates: 118815012-118817427 Strand: + Type: protein_coding

cDNA / CDS / Protein Sequences

Available sequence downloads CDS FASTA Protein FASTA cDNA FASTA

cDNA

693 bp · LXL04_030573|LXL04_030573|OH1004|cDNA

ATGTTGTCTTCACAACAGCTACCTTGTGTTCATCATCCAGGGCTGTGTACCAACGGCCGGTTCCAAAAAGGTGCAGCACCCTTTGTTGTGAGAGCAGAGCAAATATCAGCACCTTCAACCTCTCTCCAAGATAAATACGGGAGGCGGCAACTACTTGCCACTGGGGTAACAATTGCTCCATGGTTGCTTTTGTCATATAAGAAATCAACAGCGTTAGCTGGTGAAAATTCAAAGGGATTTTATCCTGTCACTGACAAGAC...

CDS

Download CDS FASTA

693 bp · LXL04_030573|LXL04_030573|OH1004|CDS

ATGTTGTCTTCACAACAGCTACCTTGTGTTCATCATCCAGGGCTGTGTACCAACGGCCGGTTCCAAAAAGGTGCAGCACCCTTTGTTGTGAGAGCAGAGCAAATATCAGCACCTTCAACCTCTCTCCAAGATAAATACGGGAGGCGGCAACTACTTGCCACTGGGGTAACAATTGCTCCATGGTTGCTTTTGTCATATAAGAAATCAACAGCGTTAGCTGGTGAAAATTCAAAGGGATTTTATCCTGTCACTGACAAGAC...

Protein

Download Protein FASTA

230 aa · LXL04_030573|LXL04_030573|OH1004|PROTEIN

MLSSQQLPCVHHPGLCTNGRFQKGAAPFVVRAEQISAPSTSLQDKYGRRQLLATGVTIAPWLLLSYKKSTALAGENSKGFYPVTDKTDGYSFIYPFGWQEIAIEGQDKVFKDVIEPLENVSVNVFPTNREDIRDLGSPQEVAEALIKKVLAPPSQKTKLLNAAEHEVDGKAYYTFEFVAQAPNFTRHALSTITIGNGKFYTLTTGANERRWGKMKDKLNTVVDSFKIFNV

Flanking Sequence Download

Sequence orientation and download details

Upstream/downstream are capped at 10000 bp per side. Negative-strand genes are reverse-complemented so the final FASTA follows transcriptional 5′→3′ orientation.

ID Mapping

Input ID	`LXL04_030573`
Source version	OH-1004 / GCA_047496595.1_OSU_TarKok_2.0

Open Full ID Mapping

SNP / Indel variants and carrier samplesCRA009020 · OH-1004

Expand to load variant records for this gene.

Basic Information and Functional Annotation

Gene ID LXL04_030573

Location Chr06:118815012-118817427 (+)

Description Similar to PPL1: PsbP-like protein 1, chloroplastic

Arabidopsis / Rice Reference Genes and Papers

Download references for this gene

Arabidopsis

Reference gene ID	Possible function	Papers / DOI
`At3g55330`	Required for efficient repair of photodamaged PSII, but not tightly associated with the complex.	Distinct functions for the two PsbP-like proteins PPL1 and PPL2 in the chloroplast thylakoid lumen of Arabidopsis.2007 · DOI: 10.1104/pp.107.105866
`At2g39470`	NDH shuttles electrons from NAD(P)H:plastoquinone, via FMN and iron-sulfur (Fe-S) centers, to quinones in the photosynthetic chain and possibly in a chloroplast respiratory chain.	Distinct functions for the two PsbP-like proteins PPL1 and PPL2 in the chloroplast thylakoid lumen of Arabidopsis.2007 · DOI: 10.1104/pp.107.105866
`At3g05410`	PsbP domain-containing protein 7, chloroplastic.	No verified direct reference in this release

Rice

No hit for this species in the current source table.

Functional annotation source

View annotation sources

Functional annotation source: OH1004 · LXL04_030573 · GCA_047496595.1_OSU_TarKok_2.0.

GO annotations (OH1004 source)

GO:0015979 photosynthesis Biological Process

GO:0048564 photosystem I assembly Biological Process

GO:0005829 cytosol Cellular Component

GO:0009507 chloroplast Cellular Component

GO:0009535 chloroplast thylakoid membrane Cellular Component

GO:0009543 chloroplast thylakoid lumen Cellular Component

GO:0009579 thylakoid Cellular Component

GO:0009654 photosystem II oxygen evolving complex Cellular Component

GO:0019898 extrinsic component of membrane Cellular Component

GO:0031977 thylakoid lumen Cellular Component

GO:0042651 thylakoid membrane Cellular Component

GO:0098807 chloroplast thylakoid membrane protein complex Cellular Component

KEGG gene cross-reference

ath:AT2G39470

ath:AT3G05410

ath:AT3G55330

syn:sll1418

tel:tlr2075

These KEGG gene identifiers are linked through homologous proteins; they do not establish pathway function for this gene.

Open Annotation Module

Gene expression

View expression in different studies, tissues and treatments. Results are presented separately by study and measurement unit.

View expression for this gene

Data sources and gene correspondence

Expression data come from public transcriptome studies. Reference genomes, sample metadata and measurement units are shown with the results. Ambiguous cross-reference correspondences do not select an expression record automatically; missing values do not mean zero expression.

Subcellular Localization Top 5

Computational predictions or homology annotations below do not replace localization experiments.

Plastid0.983

Rank 1 · LXL04_030573 · OH-1004

Mitochondrion0.026

Rank 2 · LXL04_030573 · OH-1004

Nucleus0.011

Rank 3 · LXL04_030573 · OH-1004

Cytoplasm0.011

Rank 4 · LXL04_030573 · OH-1004

Cell membrane0.008

Rank 5 · LXL04_030573 · OH-1004

LocPro · Direct prediction · Computational prediction, not experimental localization

Open Subcellular Module

Predicted Functional Domains

Domain results are from Pfam-A/HMMER; positions are amino-acid coordinates on the protein sequence.

PF01789.23PsbP78-227 aa

Gene ID	Domain ID	Domain Name	Start aa	End aa	E-value	Score
LXL04_030573	`PF01789.23`	PsbP	78	227	1.3e-56	191.7

Arabidopsis / Rice Protein Homology

Only Arabidopsis and rice are shown. Swiss-Prot entries are reviewed; TrEMBL entries are supplementary sequence candidates. Similarity is not experimental validation.

Download current result

Protein	Organism	Description	Identity	Database	Confidence
`P82538`	Arabidopsis thaliana	PsbP-like protein 1, chloroplastic	61.650%	Swiss-Prot	strong database homology
`O80634`	Arabidopsis thaliana	Photosynthetic NDH subunit of lumenal location 1, chloroplastic	37.968%	Swiss-Prot	moderate database homology
`F4J7A7`	Arabidopsis thaliana	PsbP domain-containing protein 7, chloroplastic	25.630%	Swiss-Prot	weak database homology

JBrowse

View in Genome Browser

Gene Card