LXL04_030378 | RubberDandelionOmics

Gene overview

LXL04_030378

Reference: OH-1004 Chr: Chr06 Coordinates: 115037924-115040522 Strand: - Type: protein_coding

cDNA / CDS / Protein Sequences

Available sequence downloads CDS FASTA Protein FASTA cDNA FASTA

cDNA

1809 bp · LXL04_030378|LXL04_030378|OH1004|cDNA

ATGGAGAAGAAGAGCTGGTGGAAGCGGAAGTCCTCTGACCGGAGTCCCGGCGAGACAGAAAGTTCCACTTCAATATCTTCACATTCCGAAAGCAACTCCGACGAAAAGGGAGACCACGACAGCTTACAGAAATCACAATCATCTGAAGTCACCTCAAGAGTTTCAACTCCAAACACAGAAACCAACGACAGTTATAAAAATCTGACAGAAAAGCTATCAGCGGCTCTTGTCAATGTTGGCGCTAAAGAAGATTTGGTCAA...

CDS

Download CDS FASTA

1809 bp · LXL04_030378|LXL04_030378|OH1004|CDS

ATGGAGAAGAAGAGCTGGTGGAAGCGGAAGTCCTCTGACCGGAGTCCCGGCGAGACAGAAAGTTCCACTTCAATATCTTCACATTCCGAAAGCAACTCCGACGAAAAGGGAGACCACGACAGCTTACAGAAATCACAATCATCTGAAGTCACCTCAAGAGTTTCAACTCCAAACACAGAAACCAACGACAGTTATAAAAATCTGACAGAAAAGCTATCAGCGGCTCTTGTCAATGTTGGCGCTAAAGAAGATTTGGTCAA...

Protein

Download Protein FASTA

602 aa · LXL04_030378|LXL04_030378|OH1004|PROTEIN

MEKKSWWKRKSSDRSPGETESSTSISSHSESNSDEKGDHDSLQKSQSSEVTSRVSTPNTETNDSYKNLTEKLSAALVNVGAKEDLVKQHAKVAEEAVAGWEKAENEVTQLKQQLEAALQQNLALEVRTNHLDGALKECVKQLRQSREEQEQQINKWEITKKDLELQICNLKANSQVNKSVDPKLLQKLEALEKENSDLKSSLMDQSEELEIRTIERDLSTQAAESASKHQLESIKKVAKLEAECRKLTSLTRKSPSFYVD...

Flanking Sequence Download

Sequence orientation and download details

Upstream/downstream are capped at 10000 bp per side. Negative-strand genes are reverse-complemented so the final FASTA follows transcriptional 5′→3′ orientation.

ID Mapping

Input ID	`LXL04_030378`
Source version	OH-1004 / GCA_047496595.1_OSU_TarKok_2.0

Open Full ID Mapping

SNP / Indel variants and carrier samplesCRA009020 · OH-1004

Expand to load variant records for this gene.

Basic Information and Functional Annotation

Gene ID LXL04_030378

Location Chr06:115037924-115040522 (-)

Description Similar to FPP: Filament-like plant protein (Fragment)

Arabidopsis / Rice Reference Genes and Papers

Download references for this gene

Arabidopsis

Reference gene ID	Possible function	Papers / DOI
`At3g05270`	Ensures, when in complex with COG2 and FPP2/VETH2, the correct secondary cell wall (SCW) deposition pattern by recruiting exocyst components to cortical microtubules in xylem cells during secondary cell wall deposition by recruiting EXO70A1.	No verified direct reference in this release
`At1g77580`	Filament-like plant protein 1.	No verified direct reference in this release
`At1g21810`	Ensures, when in complex with FPP3/VETH1 and COG2, the correct secondary cell wall (SCW) deposition pattern by recruiting exocyst components to cortical microtubules in xylem cells during secondary cell wall deposition by recruiting EXO70A1.	No verified direct reference in this release
`At1g19835`	Filament-like plant protein 4.	No verified direct reference in this release

Rice

No hit for this species in the current source table.

Functional annotation source

View annotation sources

Functional annotation source: OH1004 · LXL04_030378 · GCA_047496595.1_OSU_TarKok_2.0.

GO annotations (OH1004 source)

GO:0060178 regulation of exocyst localization Biological Process

GO:0005737 cytoplasm Cellular Component

GO:0005794 Golgi apparatus Cellular Component

GO:0031410 cytoplasmic vesicle Cellular Component

GO:0030674 protein-macromolecule adaptor activity Molecular Function

KEGG gene cross-reference

ath:AT1G21810

ath:AT1G77580

ath:AT3G05270

These KEGG gene identifiers are linked through homologous proteins; they do not establish pathway function for this gene.

Open Annotation Module

Gene expression

View expression in different studies, tissues and treatments. Results are presented separately by study and measurement unit.

View expression for this gene

Data sources and gene correspondence

Expression data come from public transcriptome studies. Reference genomes, sample metadata and measurement units are shown with the results. Ambiguous cross-reference correspondences do not select an expression record automatically; missing values do not mean zero expression.

Subcellular Localization Top 5

Computational predictions or homology annotations below do not replace localization experiments.

Cytoplasm0.483

Rank 1 · LXL04_030378 · OH-1004

Cell membrane0.325

Rank 2 · LXL04_030378 · OH-1004

Nucleus0.275

Rank 3 · LXL04_030378 · OH-1004

Plastid0.055

Rank 4 · LXL04_030378 · OH-1004

Golgi apparatus0.055

Rank 5 · LXL04_030378 · OH-1004

LocPro · Direct prediction · Computational prediction, not experimental localization

Open Subcellular Module

Predicted Functional Domains

Domain results are from Pfam-A/HMMER; positions are amino-acid coordinates on the protein sequence.

PF05911.17FPP82-159 aa

PF05911.17FPP183-253 aa

PF05911.17FPP278-347 aa

PF05911.17FPP340-509 aa

Gene ID	Domain ID	Domain Name	Start aa	End aa	E-value	Score
LXL04_030378	`PF05911.17`	FPP	82	159	7.8e-65	220.4
LXL04_030378	`PF05911.17`	FPP	183	253	7.8e-65	220.4
LXL04_030378	`PF05911.17`	FPP	278	347	7.8e-65	220.4
LXL04_030378	`PF05911.17`	FPP	340	509	7.8e-65	220.4

Arabidopsis / Rice Protein Homology

Only Arabidopsis and rice are shown. Swiss-Prot entries are reviewed; TrEMBL entries are supplementary sequence candidates. Similarity is not experimental validation.

Download current result

Protein	Organism	Description	Identity	Database	Confidence
`Q9MA92`	Arabidopsis thaliana	Filament-like plant protein 3	40.320%	Swiss-Prot	moderate database homology
`Q9CAP9`	Arabidopsis thaliana	Filament-like plant protein 1	47.606%	Swiss-Prot	moderate database homology
`Q9SFF4`	Arabidopsis thaliana	Filament-like plant protein 2	35.634%	Swiss-Prot	moderate database homology
`Q0WSY2`	Arabidopsis thaliana	Filament-like plant protein 4	36.333%	Swiss-Prot	weak database homology

JBrowse

View in Genome Browser

Gene Card