LXL04_030292 | RubberDandelionOmics

Gene overview

LXL04_030292

Reference: OH-1004 Chr: Chr06 Coordinates: 113597705-113600876 Strand: - Type: protein_coding

cDNA / CDS / Protein Sequences

Available sequence downloads CDS FASTA Protein FASTA cDNA FASTA

cDNA

1419 bp · LXL04_030292|LXL04_030292|OH1004|cDNA

ATGGCATCTCAAACCCATGTCAATGTCCACTCACGTCTCACCGTTGTGTCTAGCACCCCTACTGAGCCAATGGGTTCGACCAATGGTCTAACCCCAATCGACCACACCATGGGCTCACACACGGTTCATATTATATTCTACTATCGAACCAGCCCTTTTGCTAAAAAAGGTCGGTTCGCTTTGGACTTGGATAATGTCCGGGTTTCACTTTCGGACCTTTTATCCAAGTATCCACGGATGACGGGTCGGTTGTTTCGTGA...

CDS

Download CDS FASTA

1419 bp · LXL04_030292|LXL04_030292|OH1004|CDS

ATGGCATCTCAAACCCATGTCAATGTCCACTCACGTCTCACCGTTGTGTCTAGCACCCCTACTGAGCCAATGGGTTCGACCAATGGTCTAACCCCAATCGACCACACCATGGGCTCACACACGGTTCATATTATATTCTACTATCGAACCAGCCCTTTTGCTAAAAAAGGTCGGTTCGCTTTGGACTTGGATAATGTCCGGGTTTCACTTTCGGACCTTTTATCCAAGTATCCACGGATGACGGGTCGGTTGTTTCGTGA...

Protein

Download Protein FASTA

472 aa · LXL04_030292|LXL04_030292|OH1004|PROTEIN

MASQTHVNVHSRLTVVSSTPTEPMGSTNGLTPIDHTMGSHTVHIIFYYRTSPFAKKGRFALDLDNVRVSLSDLLSKYPRMTGRLFRDNDGNWGVRYNDAGVRMFKADVGITVDEWLKTADESDERNLTMWEDMPDGDPTSWSPFQIQVSEFLEGGLSIGLSFTHLLADPTSGTLFYKSWTDAERGDPTGHRTPIFSLPQLDNRPPPAATGTTCTTTEYLQKNSKLAPISSEKMATSVFKFSNSTIKQCLSKISDRCPDAN...

Flanking Sequence Download

Sequence orientation and download details

Upstream/downstream are capped at 10000 bp per side. Negative-strand genes are reverse-complemented so the final FASTA follows transcriptional 5′→3′ orientation.

ID Mapping

Input ID	`LXL04_030292`
TK1151 ID	TkA07G394800
OH-1004 ID	LXL04_030292
Relationship / confidence	Rbh High Identity Coverage Synteny / Strict
Protein identity (%)	99.800
Protein coverage (%)	TK1151 100.000 / OH-1004 100.000 Coverage and evidence Coverage is the aligned span of the best-scoring HSP divided by representative protein length. A homolog match does not establish functional validation.
Source version	OH-1004 / GCA_047496595.1_OSU_TarKok_2.0

Open Full ID Mapping

SNP / Indel variants and carrier samplesCRA009020 · OH-1004

Expand to load variant records for this gene.

Basic Information and Functional Annotation

Gene ID LXL04_030292

Location Chr06:113597705-113600876 (-)

Description Similar to CER2: Protein ECERIFERUM 2

Arabidopsis / Rice Reference Genes and Papers

Download references for this gene

Arabidopsis

Reference gene ID	Possible function	Papers / DOI
`At4g24510`	Involved in biosynthesis of the epicuticular wax.	Composition of alkyl esters in the cuticular wax on inflorescence stems of Arabidopsis thaliana cer mutants.2007 · DOI: 10.1111/j.1365-313x.2007.03054.x Arabidopsis ECERIFERUM2 is a component of the fatty acid elongation machinery required for fatty acid extension to exceptional lengths.2012 · DOI: 10.1104/pp.112.201640 The Arabidopsis cer26 mutant, like the cer2 mutant, is specifically affected in the very long chain fatty acid elongation process.2013 · DOI: 10.1111/tpj.12060
`At3g23840`	Involved in biosynthesis of the epicuticular wax.	No verified direct reference in this release

Rice

Reference gene ID	Possible function	Papers / DOI
`Os02g0611800`	Hydroxycinnamoyl transferase that catalyzes the transfer of an acyl from p-coumaryol-CoA to various acyl acceptors.	No verified direct reference in this release
`Os04g0500700`	Hydroxycinnamoyl transferase that catalyzes the transfer of an acyl from p-coumaryol-CoA to various acyl acceptors.	No verified direct reference in this release

Functional annotation source

View annotation sources

Functional annotation source: OH1004 · LXL04_030292 · GCA_047496595.1_OSU_TarKok_2.0.

GO annotations (OH1004 source)

GO:0009555 pollen development Biological Process

GO:0010025 wax biosynthetic process Biological Process

GO:0042761 very long-chain fatty acid biosynthetic process Biological Process

GO:0071555 cell wall organization Biological Process

GO:0005634 nucleus Cellular Component

GO:0005783 endoplasmic reticulum Cellular Component

GO:0009535 chloroplast thylakoid membrane Cellular Component

GO:0016747 acyltransferase activity, transferring groups other than amino-acyl groups Molecular Function

GO:0050734 hydroxycinnamoyltransferase activity Molecular Function

KEGG gene cross-reference

ath:AT3G23840

ath:AT4G24510

dosa:Os02g0611800

dosa:Os04g0500700

osa:4336306

These KEGG gene identifiers are linked through homologous proteins; they do not establish pathway function for this gene.

Open Annotation Module

Gene expression

View expression in different studies, tissues and treatments. Results are presented separately by study and measurement unit.

View expression for this gene

Data sources and gene correspondence

Expression data come from public transcriptome studies. Reference genomes, sample metadata and measurement units are shown with the results. Ambiguous cross-reference correspondences do not select an expression record automatically; missing values do not mean zero expression.

Subcellular Localization Top 5

Computational predictions or homology annotations below do not replace localization experiments.

Cytoplasm0.581

Rank 1 · LXL04_030292 · OH-1004

Nucleus0.340

Rank 2 · LXL04_030292 · OH-1004

Cell membrane0.131

Rank 3 · LXL04_030292 · OH-1004

Endoplasmic reticulum0.098

Rank 4 · LXL04_030292 · OH-1004

Golgi apparatus0.052

Rank 5 · LXL04_030292 · OH-1004

LocPro · Direct prediction · Computational prediction, not experimental localization

Open Subcellular Module

Predicted Functional Domains

Domain results are from Pfam-A/HMMER; positions are amino-acid coordinates on the protein sequence.

PF02458.21Transferase6-455 aa

Gene ID	Domain ID	Domain Name	Start aa	End aa	E-value	Score
LXL04_030292	`PF02458.21`	Transferase	6	455	4e-40	138.5

Arabidopsis / Rice Protein Homology

Only Arabidopsis and rice are shown. Swiss-Prot entries are reviewed; TrEMBL entries are supplementary sequence candidates. Similarity is not experimental validation.

Download current result

Protein	Organism	Description	Identity	Database	Confidence
`Q39048`	Arabidopsis thaliana	Protein ECERIFERUM 2	25.455%	Swiss-Prot	weak database homology
`Q9LIS1`	Arabidopsis thaliana	Protein ECERIFERUM 26-like	25.561%	Swiss-Prot	weak database homology
`Q6K638`	Oryza sativa subsp. japonica	Hydroxycinnamoyltransferase 2	26.316%	Swiss-Prot	weak database homology
`Q0JBZ8`	Oryza sativa subsp. japonica	Hydroxycinnamoyltransferase 1	27.844%	Swiss-Prot	weak database homology

JBrowse

View in Genome Browser

Gene Card