Gene Card
Gene overview
cDNA / CDS / Protein Sequences
459 bp · LXL04_029904|LXL04_029904|OH1004|cDNA
ATGCTCTACTACCTGCACCGTCTCCAGCCTTACGTGTATCATGTTGCTCGAAAAAAAGCCCCGTCGACTGCTCATAGTGTAACAAAAACTTCGTATCGTTTCGTGTTTGGTAGGCTTATTTTCTTATCTCTACTTTCAGGCCGCCACCCGTTTGTCGAAATGCCTGAACCACTAATGGGGTTGAAAGGAAAACAGGAGATCAATCACCCAATAAGAAATCTTCATCTGAATTCAAAATTGTCGGCTTCCAGAAGGGGTTC...
459 bp · LXL04_029904|LXL04_029904|OH1004|CDS
ATGCTCTACTACCTGCACCGTCTCCAGCCTTACGTGTATCATGTTGCTCGAAAAAAAGCCCCGTCGACTGCTCATAGTGTAACAAAAACTTCGTATCGTTTCGTGTTTGGTAGGCTTATTTTCTTATCTCTACTTTCAGGCCGCCACCCGTTTGTCGAAATGCCTGAACCACTAATGGGGTTGAAAGGAAAACAGGAGATCAATCACCCAATAAGAAATCTTCATCTGAATTCAAAATTGTCGGCTTCCAGAAGGGGTTC...
Protein
Download Protein FASTA152 aa · LXL04_029904|LXL04_029904|OH1004|PROTEIN
MLYYLHRLQPYVYHVARKKAPSTAHSVTKTSYRFVFGRLIFLSLLSGRHPFVEMPEPLMGLKGKQEINHPIRNLHLNSKLSASRRGSWSTKGEHGIYESPMSLKPCPLTFNQCTPMKQSSSMIRSSIRRASLSEVTGTPVTVKKKTMLLLLW
Flanking Sequence Download
Sequence orientation and download details
Upstream/downstream are capped at 10000 bp per side. Negative-strand genes are reverse-complemented so the final FASTA follows transcriptional 5′→3′ orientation.
ID Mapping
| Input ID | LXL04_029904 |
|---|---|
| Source version | OH-1004 / GCA_047496595.1_OSU_TarKok_2.0 |
SNP / Indel variants and carrier samplesCRA009020 · OH-1004
Expand to load variant records for this gene.
Basic Information and Functional Annotation
| Gene ID | LXL04_029904 | ||||||
|---|---|---|---|---|---|---|---|
| Location | Chr06:103153683-103154141 (+) | ||||||
| Description | Protein of unknown function | ||||||
| Arabidopsis / Rice Reference Genes and Papers |
Download references for this gene Arabidopsis
RiceNo hit for this species in the current source table. | ||||||
| Functional annotation source | View annotation sourcesFunctional annotation source: OH1004 · | ||||||
| GO annotations (OH1004 source) | GO:0000226 microtubule cytoskeleton organization Biological Process GO:0007020 microtubule nucleation Biological Process GO:0005634 nucleus Cellular Component GO:0005874 microtubule Cellular Component GO:0008017 microtubule binding Molecular Function GO:0043015 gamma-tubulin binding Molecular Function GO:0060090 molecular adaptor activity Molecular Function | ||||||
| KEGG gene cross-reference | ath:AT1G23790 These KEGG gene identifiers are linked through homologous proteins; they do not establish pathway function for this gene. |
Gene expression
View expression in different studies, tissues and treatments. Results are presented separately by study and measurement unit.
Data sources and gene correspondence
Expression data come from public transcriptome studies. Reference genomes, sample metadata and measurement units are shown with the results. Ambiguous cross-reference correspondences do not select an expression record automatically; missing values do not mean zero expression.
Subcellular Localization Top 5
Computational predictions or homology annotations below do not replace localization experiments.
LocPro · Direct prediction · Computational prediction, not experimental localization
Predicted Functional Domains
No result was found for this query.
Arabidopsis / Rice Protein Homology
Only Arabidopsis and rice are shown. Swiss-Prot entries are reviewed; TrEMBL entries are supplementary sequence candidates. Similarity is not experimental validation.
| Protein | Organism | Description | Identity | Database | Confidence |
|---|---|---|---|---|---|
Q9ZUB7 | Arabidopsis thaliana | Protein CORTICAL MICROTUBULE DISORDERING 4 | 45.205% | Swiss-Prot | weak database homology |