LXL04_029859 | RubberDandelionOmics

Gene overview

LXL04_029859

Reference: OH-1004 Chr: Chr06 Coordinates: 102328683-102331307 Strand: + Type: protein_coding

cDNA / CDS / Protein Sequences

Available sequence downloads CDS FASTA Protein FASTA cDNA FASTA

cDNA

642 bp · LXL04_029859|LXL04_029859|OH1004|cDNA

ATGGGCTGCTTTCATTCTACTGTTAGAAAACCGGTTCCTGGACATGAAAACCCTACTATTCTTGCTTCTCAAACAGCCTTTAGTGTCAGTGAAGTTGAAGCACTCTTTGAGCTCTTCAAGAGCATAAGCAGTTCTGTAATCGATGATGGATTAATTAACAAGGAAGAATTTCAACTAGCTTTATTCAAGAACAGGAAGAAAGAGAATTTATTTGCAAACAGGATATTTGATCTTTTTGATGTGAAACAAAAGGGTGTTAT...

CDS

Download CDS FASTA

642 bp · LXL04_029859|LXL04_029859|OH1004|CDS

ATGGGCTGCTTTCATTCTACTGTTAGAAAACCGGTTCCTGGACATGAAAACCCTACTATTCTTGCTTCTCAAACAGCCTTTAGTGTCAGTGAAGTTGAAGCACTCTTTGAGCTCTTCAAGAGCATAAGCAGTTCTGTAATCGATGATGGATTAATTAACAAGGAAGAATTTCAACTAGCTTTATTCAAGAACAGGAAGAAAGAGAATTTATTTGCAAACAGGATATTTGATCTTTTTGATGTGAAACAAAAGGGTGTTAT...

Protein

Download Protein FASTA

213 aa · LXL04_029859|LXL04_029859|OH1004|PROTEIN

MGCFHSTVRKPVPGHENPTILASQTAFSVSEVEALFELFKSISSSVIDDGLINKEEFQLALFKNRKKENLFANRIFDLFDVKQKGVIDFGDFVRALNVFHPNAPQEDKISFCFKLYDMDGTGFIERQEVKQMLIALLCESELKLADDTIEIILDKTFSEADVDQDGKIDKSEWHNFVTKNPSLLKIMTLPYLRDITTTFPSFVFNSEVEEIAT

Flanking Sequence Download

Sequence orientation and download details

Upstream/downstream are capped at 10000 bp per side. Negative-strand genes are reverse-complemented so the final FASTA follows transcriptional 5′→3′ orientation.

ID Mapping

Input ID	`LXL04_029859`
Source version	OH-1004 / GCA_047496595.1_OSU_TarKok_2.0

Open Full ID Mapping

SNP / Indel variants and carrier samplesCRA009020 · OH-1004

Expand to load variant records for this gene.

Basic Information and Functional Annotation

Gene ID LXL04_029859

Location Chr06:102328683-102331307 (+)

Description Similar to CBL9: Calcineurin B-like protein 9

Arabidopsis / Rice Reference Genes and Papers

Download references for this gene

Arabidopsis

Reference gene ID	Possible function	Papers / DOI
`At5g47100`	Acts as a calcium sensor involved in abscisic acid (ABA) signaling and stress-induced ABA biosynthesis pathways.	The calcium sensor calcineurin B-like 9 modulates abscisic acid sensitivity and biosynthesis in Arabidopsis.2004 · DOI: 10.1105/tpc.021311 A protein kinase, interacting with two calcineurin B-like proteins, regulates K+ transporter AKT1 in Arabidopsis.2006 · DOI: 10.1016/j.cell.2006.06.011 Two calcineurin B-like calcium sensors, interacting with protein kinase CIPK23, regulate leaf transpiration and root potassium uptake in Arabidopsis.2007 · DOI: 10.1111/j.1365-313x.2007.03236.x The Calcineurin B-like calcium sensors CBL1 and CBL9 together with their interacting protein kinase CIPK26 regulate the Arabidopsis NADPH oxidase RBOHF.2013 · DOI: 10.1093/mp/sst009
`At4g17615`	Acts as a calcium sensor involved in the signaling pathway during growth and development and in response to abiotic stresses.	A calcium sensor and its interacting protein kinase are global regulators of abscisic acid signaling in Arabidopsis.2002 · DOI: 10.1016/s1534-5807(02)00229-0 CBL1, a calcium sensor that differentially regulates salt, drought, and cold responses in Arabidopsis.2003 · DOI: 10.1105/tpc.012393 The calcium sensor CBL1 integrates plant responses to abiotic stresses.2003 · DOI: 10.1046/j.1365-313x.2003.01892.x A protein kinase, interacting with two calcineurin B-like proteins, regulates K+ transporter AKT1 in Arabidopsis.2006 · DOI: 10.1016/j.cell.2006.06.011 Two calcineurin B-like calcium sensors, interacting with protein kinase CIPK23, regulate leaf transpiration and root potassium uptake in Arabidopsis.2007 · DOI: 10.1111/j.1365-313x.2007.03236.x The Calcineurin B-like calcium sensors CBL1 and CBL9 together with their interacting protein kinase CIPK26 regulate the Arabidopsis NADPH oxidase RBOHF.2013 · DOI: 10.1093/mp/sst009 A novel role for Arabidopsis CBL1 in affecting plant responses to glucose and gibberellin during germination and seedling development.2013 · DOI: 10.1371/journal.pone.0056412
`At5g55990`	Acts as a calcium sensor.	Arabidopsis protein kinase PKS5 inhibits the plasma membrane H+ -ATPase by preventing interaction with 14-3-3 protein.2007 · DOI: 10.1105/tpc.105.035626 S-acylation-dependent association of the calcium sensor CBL2 with the vacuolar membrane is essential for proper abscisic acid responses.2012 · DOI: 10.1038/cr.2012.71

Rice

Reference gene ID	Possible function	Papers / DOI
`Os10g0564800`	Acts as a calcium sensor.	No verified direct reference in this release
`Os02g0291000`	Acts as a calcium sensor.	No verified direct reference in this release

Functional annotation source

View annotation sources

Functional annotation source: OH1004 · LXL04_029859 · GCA_047496595.1_OSU_TarKok_2.0.

GO annotations (OH1004 source)

GO:0006970 response to osmotic stress Biological Process

GO:0009409 response to cold Biological Process

GO:0009414 response to water deprivation Biological Process

GO:0009651 response to salt stress Biological Process

GO:0009738 abscisic acid-activated signaling pathway Biological Process

GO:0009860 pollen tube growth Biological Process

GO:0016036 cellular response to phosphate starvation Biological Process

GO:0019722 calcium-mediated signaling Biological Process

GO:0055075 potassium ion homeostasis Biological Process

GO:0000325 plant-type vacuole Cellular Component

GO:0005737 cytoplasm Cellular Component

GO:0005773 vacuole Cellular Component

KEGG gene cross-reference

ath:AT4G17615

ath:AT5G47100

ath:AT5G55990

dosa:Os02g0291000

These KEGG gene identifiers are linked through homologous proteins; they do not establish pathway function for this gene.

Open Annotation Module

Gene expression

View expression in different studies, tissues and treatments. Results are presented separately by study and measurement unit.

View expression for this gene

Data sources and gene correspondence

Expression data come from public transcriptome studies. Reference genomes, sample metadata and measurement units are shown with the results. Ambiguous cross-reference correspondences do not select an expression record automatically; missing values do not mean zero expression.

Subcellular Localization Top 5

Computational predictions or homology annotations below do not replace localization experiments.

Cytoplasm0.460

Rank 1 · LXL04_029859 · OH-1004

Cell membrane0.335

Rank 2 · LXL04_029859 · OH-1004

Nucleus0.164

Rank 3 · LXL04_029859 · OH-1004

Lysosome / Vacuole0.141

Rank 4 · LXL04_029859 · OH-1004

Golgi apparatus0.111

Rank 5 · LXL04_029859 · OH-1004

LocPro · Direct prediction · Computational prediction, not experimental localization

Open Subcellular Module

Predicted Functional Domains

Domain results are from Pfam-A/HMMER; positions are amino-acid coordinates on the protein sequence.

PF00036.39EF-hand_173-97 aa

PF13499.13EF-hand_7106-155 aa

PF00036.39EF-hand_1110-135 aa

PF13405.13EF-hand_6111-135 aa

PF00036.39EF-hand_1153-179 aa

PF13202.13EF-hand_5153-177 aa

Gene ID	Domain ID	Domain Name	Start aa	End aa	E-value	Score
LXL04_029859	`PF00036.39`	EF-hand_1	73	97	4.5e-20	70.3
LXL04_029859	`PF13499.13`	EF-hand_7	106	155	9.5e-15	55.4
LXL04_029859	`PF00036.39`	EF-hand_1	110	135	4.5e-20	70.3
LXL04_029859	`PF13405.13`	EF-hand_6	111	135	4.1e-17	60.9
LXL04_029859	`PF00036.39`	EF-hand_1	153	179	4.5e-20	70.3
LXL04_029859	`PF13202.13`	EF-hand_5	153	177	1.3e-14	53.6

Arabidopsis / Rice Protein Homology

Only Arabidopsis and rice are shown. Swiss-Prot entries are reviewed; TrEMBL entries are supplementary sequence candidates. Similarity is not experimental validation.

Download current result

Protein	Organism	Description	Identity	Database	Confidence
`Q9LTB8`	Arabidopsis thaliana	Calcineurin B-like protein 9	85.446%	Swiss-Prot	strong database homology
`O81445`	Arabidopsis thaliana	Calcineurin B-like protein 1	83.568%	Swiss-Prot	strong database homology
`Q8LAS7`	Arabidopsis thaliana	Calcineurin B-like protein 2	64.762%	Swiss-Prot	strong database homology
`Q7XC27`	Oryza sativa subsp. japonica	Calcineurin B-like protein 1	80.282%	Swiss-Prot	strong database homology
`Q3HRP0`	Oryza sativa subsp. japonica	Calcineurin B-like protein 7	62.381%	Swiss-Prot	strong database homology

JBrowse

View in Genome Browser

Gene Card