LXL04_029762 | RubberDandelionOmics

Gene overview

LXL04_029762

Reference: OH-1004 Chr: Chr06 Coordinates: 99864711-99871459 Strand: - Type: protein_coding

cDNA / CDS / Protein Sequences

Available sequence downloads CDS FASTA Protein FASTA cDNA FASTA

cDNA

5796 bp · LXL04_029762|LXL04_029762|OH1004|cDNA

ATGGATTATGATGACAATGATGCTCAAGACCAAAATCTACACTTAAGTGGGGAAGGAAGCTCTAAAGTTTCTCCTGTATTACATTCATACCCTCTTCCACGATTTGACTTTGATGATAACCTACAAGAGCATCTAAGATTTGACAGTTTAGTTGAAAACGAGGTATTTTTAGGTATCACAAGTCAGGAAGACAATCATTGGATTGAGGAATACTCACGTGGAACTACTGCAATACCATTTAATTCAAGTGTGGCTGAATC...

CDS

Download CDS FASTA

5796 bp · LXL04_029762|LXL04_029762|OH1004|CDS

ATGGATTATGATGACAATGATGCTCAAGACCAAAATCTACACTTAAGTGGGGAAGGAAGCTCTAAAGTTTCTCCTGTATTACATTCATACCCTCTTCCACGATTTGACTTTGATGATAACCTACAAGAGCATCTAAGATTTGACAGTTTAGTTGAAAACGAGGTATTTTTAGGTATCACAAGTCAGGAAGACAATCATTGGATTGAGGAATACTCACGTGGAACTACTGCAATACCATTTAATTCAAGTGTGGCTGAATC...

Protein

Download Protein FASTA

1931 aa · LXL04_029762|LXL04_029762|OH1004|PROTEIN

MDYDDNDAQDQNLHLSGEGSSKVSPVLHSYPLPRFDFDDNLQEHLRFDSLVENEVFLGITSQEDNHWIEEYSRGTTAIPFNSSVAESRNQNVWSEATSSESVEMLLKSVGQEEKVLEATMVEELDPNLKQSDGDQETEVSHEGLDSVVVGDTYGSSSTLGDEMQEDPSVSKVECEIVGSIQNVDASVEECQNDNPVEVSETLNENASDKTSDDAIKEGSDLANESFVTELQGHSNVSKVECGNAGSSQNVIDSVKVHEMQ...

Flanking Sequence Download

Sequence orientation and download details

Upstream/downstream are capped at 10000 bp per side. Negative-strand genes are reverse-complemented so the final FASTA follows transcriptional 5′→3′ orientation.

ID Mapping

Input ID	`LXL04_029762`
TK1151 ID	TkA07G345320
OH-1004 ID	LXL04_029762
Relationship / confidence	Sequence Supported Annotation Or Model Conflict / Review
Protein identity (%)	98.800
Protein coverage (%)	TK1151 100.000 / OH-1004 57.483 Coverage and evidence Coverage is the aligned span of the best-scoring HSP divided by representative protein length. A homolog match does not establish functional validation.
Source version	OH-1004 / GCA_047496595.1_OSU_TarKok_2.0

Open Full ID Mapping

SNP / Indel variants and carrier samplesCRA009020 · OH-1004

Expand to load variant records for this gene.

Basic Information and Functional Annotation

Gene ID LXL04_029762

Location Chr06:99864711-99871459 (-)

Description Protein of unknown function

Arabidopsis / Rice Reference Genes and Papers

Download references for this gene

Arabidopsis

Reference gene ID	Possible function	Papers / DOI
`At4g17330`	May regulate root reactive oxygen species accumulation and cell-wall integrity under salt stress.	SWO1 modulates cell wall integrity under salt stress by interacting with importin ɑ in Arabidopsis.2021 · DOI: 10.1007/s44154-021-00010-5

Rice

No hit for this species in the current source table.

Functional annotation source

View annotation sources

Functional annotation source: OH1004 · LXL04_029762 · GCA_047496595.1_OSU_TarKok_2.0.

GO annotations (OH1004 source)

GO:0009651 response to salt stress Biological Process

GO:0009934 regulation of meristem structural organization Biological Process

GO:0010468 regulation of gene expression Biological Process

GO:0071555 cell wall organization Biological Process

GO:2000280 regulation of root development Biological Process

GO:0005634 nucleus Cellular Component

GO:0009506 plasmodesma Cellular Component

GO:1990841 promoter-specific chromatin binding Molecular Function

KEGG gene cross-reference

ath:AT4G17330

These KEGG gene identifiers are linked through homologous proteins; they do not establish pathway function for this gene.

Open Annotation Module

Gene expression

View expression in different studies, tissues and treatments. Results are presented separately by study and measurement unit.

View expression for this gene

Data sources and gene correspondence

Expression data come from public transcriptome studies. Reference genomes, sample metadata and measurement units are shown with the results. Ambiguous cross-reference correspondences do not select an expression record automatically; missing values do not mean zero expression.

Subcellular Localization Top 5

Computational predictions or homology annotations below do not replace localization experiments.

Nucleus0.963

Rank 1 · LXL04_029762 · OH-1004

Cytoplasm0.084

Rank 2 · LXL04_029762 · OH-1004

Cell membrane0.039

Rank 3 · LXL04_029762 · OH-1004

Endoplasmic reticulum0.019

Rank 4 · LXL04_029762 · OH-1004

Plastid0.010

Rank 5 · LXL04_029762 · OH-1004

LocPro · Direct prediction · Computational prediction, not experimental localization

Open Subcellular Module

Predicted Functional Domains

Domain results are from Pfam-A/HMMER; positions are amino-acid coordinates on the protein sequence.

PF05641.19Agenet1509-1573 aa

Gene ID	Domain ID	Domain Name	Start aa	End aa	E-value	Score
LXL04_029762	`PF05641.19`	Agenet	1509	1573	2.2e-14	54.3

Arabidopsis / Rice Protein Homology

Only Arabidopsis and rice are shown. Swiss-Prot entries are reviewed; TrEMBL entries are supplementary sequence candidates. Similarity is not experimental validation.

Download current result

Protein	Organism	Description	Identity	Database	Confidence
`F4JP43`	Arabidopsis thaliana	Protein SWOLLEN 1	35.078%	Swiss-Prot	moderate database homology

JBrowse

View in Genome Browser

Gene Card