LXL04_029467 | RubberDandelionOmics

Gene overview

LXL04_029467

Reference: OH-1004 Chr: Chr06 Coordinates: 91439496-91444766 Strand: - Type: protein_coding

cDNA / CDS / Protein Sequences

Available sequence downloads CDS FASTA Protein FASTA cDNA FASTA

cDNA

1875 bp · LXL04_029467|LXL04_029467|OH1004|cDNA

ATGATAATTAAAGCGTCTCAACACCTTTTGGGTGTAATTTTCTTCATGGAGGAAAATCTCATCTTTACGGTGGGGTTTCCAAATCTCTTCAAGAAGACGAACACCCTTTTCTTAAACGCTAGCTTTTTAGTGTTGATTCTTCAtcttcttggtgaaatgggtACGATACAGAAAGATTCAATCGTTAAAAAAGTGCTCAAGAATGTTTGTTGCAATTATGGATGGTGTTATGGTGCTTTATGGAGTTATCAACAGCCACA...

CDS

Download CDS FASTA

1875 bp · LXL04_029467|LXL04_029467|OH1004|CDS

ATGATAATTAAAGCGTCTCAACACCTTTTGGGTGTAATTTTCTTCATGGAGGAAAATCTCATCTTTACGGTGGGGTTTCCAAATCTCTTCAAGAAGACGAACACCCTTTTCTTAAACGCTAGCTTTTTAGTGTTGATTCTTCATCTTCTTGGTGAAATGGGTACGATACAGAAAGATTCAATCGTTAAAAAAGTGCTCAAGAATGTTTGTTGCAATTATGGATGGTGTTATGGTGCTTTATGGAGTTATCAACAGCCACA...

Protein

Download Protein FASTA

624 aa · LXL04_029467|LXL04_029467|OH1004|PROTEIN

MIIKASQHLLGVIFFMEENLIFTVGFPNLFKKTNTLFLNASFLVLILHLLGEMGTIQKDSIVKKVLKNVCCNYGWCYGALWSYQQPHSSLLTLQDAYFDEKFKGLINNLPLQVPIGGGITGQAAYTNKHMWMSSEDHYKEHSFSGSIWDMFLDECEFRRQISSGMKTILVIPLESQGVVQFGSDQKFLERIEFVNQTKGIFQEIVNGGGREFDSYSLNQSLLSSNLVFNAFPDFGIPDEFFRTEDFNVSQFNPFDLDVKR...

Flanking Sequence Download

Sequence orientation and download details

Upstream/downstream are capped at 10000 bp per side. Negative-strand genes are reverse-complemented so the final FASTA follows transcriptional 5′→3′ orientation.

ID Mapping

Input ID	`LXL04_029467`
TK1151 ID	TkA07G313720
OH-1004 ID	LXL04_029467
Relationship / confidence	Rbh Sequence Supported / Probable
Protein identity (%)	99.100
Protein coverage (%)	TK1151 97.028 / OH-1004 73.237 Coverage and evidence Coverage is the aligned span of the best-scoring HSP divided by representative protein length. A homolog match does not establish functional validation.
Source version	OH-1004 / GCA_047496595.1_OSU_TarKok_2.0

Open Full ID Mapping

SNP / Indel variants and carrier samplesCRA009020 · OH-1004

Expand to load variant records for this gene.

Basic Information and Functional Annotation

Gene ID LXL04_029467

Location Chr06:91439496-91444766 (-)

Description Similar to BHLH157: Transcription factor bHLH157

Arabidopsis / Rice Reference Genes and Papers

Download references for this gene

Arabidopsis

Reference gene ID	Possible function	Papers / DOI
`At1g64625`	Transcription factor that may regulate root development.	No verified direct reference in this release
`At2g27230`	Transcription activator that regulates root development; promotes the production of stele cells in roots.	No verified direct reference in this release
`At1g06150`	Transcription factor that may regulate root development.	No verified direct reference in this release
`At2g31280`	Transcription factor that may regulate root development.	No verified direct reference in this release

Rice

No hit for this species in the current source table.

Functional annotation source

View annotation sources

Functional annotation source: OH1004 · LXL04_029467 · GCA_047496595.1_OSU_TarKok_2.0.

GO annotations (OH1004 source)

GO:0006351 DNA-templated transcription Biological Process

GO:0006355 regulation of DNA-templated transcription Biological Process

GO:0007140 male meiotic nuclear division Biological Process

GO:0010078 maintenance of root meristem identity Biological Process

GO:0010089 xylem development Biological Process

GO:0010479 stele development Biological Process

GO:0045893 positive regulation of DNA-templated transcription Biological Process

GO:0048316 seed development Biological Process

GO:0048364 root development Biological Process

GO:0051321 meiotic cell cycle Biological Process

GO:0071365 cellular response to auxin stimulus Biological Process

GO:0090058 metaxylem development Biological Process

KEGG gene cross-reference

ath:AT1G06150

ath:AT1G64625

ath:AT2G27230

These KEGG gene identifiers are linked through homologous proteins; they do not establish pathway function for this gene.

Open Annotation Module

Gene expression

View expression in different studies, tissues and treatments. Results are presented separately by study and measurement unit.

View expression for this gene

Data sources and gene correspondence

Expression data come from public transcriptome studies. Reference genomes, sample metadata and measurement units are shown with the results. Ambiguous cross-reference correspondences do not select an expression record automatically; missing values do not mean zero expression.

Subcellular Localization Top 5

Computational predictions or homology annotations below do not replace localization experiments.

Nucleus0.953

Rank 1 · LXL04_029467 · OH-1004

Cytoplasm0.112

Rank 2 · LXL04_029467 · OH-1004

Cell membrane0.030

Rank 3 · LXL04_029467 · OH-1004

Endoplasmic reticulum0.020

Rank 4 · LXL04_029467 · OH-1004

Plastid0.014

Rank 5 · LXL04_029467 · OH-1004

LocPro · Direct prediction · Computational prediction, not experimental localization

Open Subcellular Module

Predicted Functional Domains

Domain results are from Pfam-A/HMMER; positions are amino-acid coordinates on the protein sequence.

PF14215.13bHLH-MYC_N113-201 aa

PF23176.1bHLH_LHW418-477 aa

Gene ID	Domain ID	Domain Name	Start aa	End aa	E-value	Score
LXL04_029467	`PF14215.13`	bHLH-MYC_N	113	201	4.7e-17	63.6
LXL04_029467	`PF23176.1`	bHLH_LHW	418	477	2.7e-23	82.4

Arabidopsis / Rice Protein Homology

Only Arabidopsis and rice are shown. Swiss-Prot entries are reviewed; TrEMBL entries are supplementary sequence candidates. Similarity is not experimental validation.

Download current result

Protein	Organism	Description	Identity	Database	Confidence
`Q7XJU0`	Arabidopsis thaliana	Transcription factor bHLH157	34.312%	Swiss-Prot	moderate database homology
`Q9XIN0`	Arabidopsis thaliana	Transcription factor LHW	49.746%	Swiss-Prot	weak database homology
`P0C7P8`	Arabidopsis thaliana	Transcription factor EMB1444	43.229%	Swiss-Prot	weak database homology
`Q58G01`	Arabidopsis thaliana	Transcription factor bHLH155	43.085%	Swiss-Prot	weak database homology

JBrowse

View in Genome Browser

Gene Card