LXL04_028733 | RubberDandelionOmics

Gene overview

LXL04_028733

Reference: OH-1004 Chr: Chr06 Coordinates: 58081592-58083950 Strand: + Type: protein_coding

cDNA / CDS / Protein Sequences

Available sequence downloads CDS FASTA Protein FASTA cDNA FASTA

cDNA

1191 bp · LXL04_028733|LXL04_028733|OH1004|cDNA

aTGGTAGCAGAAGAAAGAATGATGAGCCAAGAAGAAGAGATGACCAGCATGAAGAATAAGcaagaagaagaggaagatgatgatcatgaaaagGATATAGTGATGCCAGGGTTTCGATTTCATCCAACGGAGGACGAGCTTGTTGAGTTCTACCTTCGCCGTAAAGTAGAGGGCAAGAGATTCAATGTTGAACTCATCACTTTTCTTGATCTTTATCGTTATGATCCTTGGGAACTTCCGGCATTGGCAGCAATTGGAGA...

CDS

Download CDS FASTA

1191 bp · LXL04_028733|LXL04_028733|OH1004|CDS

ATGGTAGCAGAAGAAAGAATGATGAGCCAAGAAGAAGAGATGACCAGCATGAAGAATAAGCAAGAAGAAGAGGAAGATGATGATCATGAAAAGGATATAGTGATGCCAGGGTTTCGATTTCATCCAACGGAGGACGAGCTTGTTGAGTTCTACCTTCGCCGTAAAGTAGAGGGCAAGAGATTCAATGTTGAACTCATCACTTTTCTTGATCTTTATCGTTATGATCCTTGGGAACTTCCGGCATTGGCAGCAATTGGAGA...

Protein

Download Protein FASTA

396 aa · LXL04_028733|LXL04_028733|OH1004|PROTEIN

MVAEERMMSQEEEMTSMKNKQEEEEDDDHEKDIVMPGFRFHPTEDELVEFYLRRKVEGKRFNVELITFLDLYRYDPWELPALAAIGEKEWFFYVPRDRKYRNGDRPNRVTTSGYWKATGADRMIRTDNNKSIGLKKTLVFYSGKAPKGIRTSWIMNEYRLPQHENQRSQKAEISLCRVYKRAGVEDHPSLPRTLPTTRATSSRASNAEKKKHSHNLLCLHSLECKNPSQNDDKLSETSCSSTTDIVGTALGLSNPINHSY...

Flanking Sequence Download

Sequence orientation and download details

Upstream/downstream are capped at 10000 bp per side. Negative-strand genes are reverse-complemented so the final FASTA follows transcriptional 5′→3′ orientation.

ID Mapping

Input ID	`LXL04_028733`
Source version	OH-1004 / GCA_047496595.1_OSU_TarKok_2.0

Open Full ID Mapping

SNP / Indel variants and carrier samplesCRA009020 · OH-1004

Expand to load variant records for this gene.

Basic Information and Functional Annotation

Gene ID LXL04_028733

Location Chr06:58081592-58083950 (+)

Description Similar to NAC035: NAC domain-containing protein 35

Arabidopsis / Rice Reference Genes and Papers

Download references for this gene

Arabidopsis

Reference gene ID	Possible function	Papers / DOI
`At2g02450`	Transcription factor that acts as a floral repressor.	Control of flowering time and cold response by a NAC-domain protein in Arabidopsis.2007 · DOI: 10.1371/journal.pone.0000642
`At5g39820`	Putative NAC domain-containing protein 94.	No verified direct reference in this release
`At1g26870`	Promotes periclinal root capforming cell divisions.	No verified direct reference in this release

Rice

Reference gene ID	Possible function	Papers / DOI
`Os03g0133000`	Transcription activator that binds sequence-specific DNA motifs.	No verified direct reference in this release

Functional annotation source

View annotation sources

Functional annotation source: OH1004 · LXL04_028733 · GCA_047496595.1_OSU_TarKok_2.0.

GO annotations (OH1004 source)

GO:0006351 DNA-templated transcription Biological Process

GO:0006355 regulation of DNA-templated transcription Biological Process

GO:0009733 response to auxin Biological Process

GO:0009908 flower development Biological Process

GO:0045770 positive regulation of asymmetric cell division Biological Process

GO:0045893 positive regulation of DNA-templated transcription Biological Process

GO:0048103 somatic stem cell division Biological Process

GO:0048829 root cap development Biological Process

GO:0099402 plant organ development Biological Process

GO:1901002 positive regulation of response to salt stress Biological Process

GO:1902584 positive regulation of response to water deprivation Biological Process

GO:0005634 nucleus Cellular Component

KEGG gene cross-reference

ath:AT1G26870

ath:AT2G02450

ath:AT5G39820

dosa:Os03g0133000

gmx:732555

osa:4331520

These KEGG gene identifiers are linked through homologous proteins; they do not establish pathway function for this gene.

Open Annotation Module

Gene expression

View expression in different studies, tissues and treatments. Results are presented separately by study and measurement unit.

View expression for this gene

Data sources and gene correspondence

Expression data come from public transcriptome studies. Reference genomes, sample metadata and measurement units are shown with the results. Ambiguous cross-reference correspondences do not select an expression record automatically; missing values do not mean zero expression.

Subcellular Localization Top 5

Computational predictions or homology annotations below do not replace localization experiments.

Nucleus0.925

Rank 1 · LXL04_028733 · OH-1004

Cytoplasm0.123

Rank 2 · LXL04_028733 · OH-1004

Cell membrane0.052

Rank 3 · LXL04_028733 · OH-1004

Endoplasmic reticulum0.037

Rank 4 · LXL04_028733 · OH-1004

Plastid0.016

Rank 5 · LXL04_028733 · OH-1004

LocPro · Direct prediction · Computational prediction, not experimental localization

Open Subcellular Module

Predicted Functional Domains

Domain results are from Pfam-A/HMMER; positions are amino-acid coordinates on the protein sequence.

PF02365.21NAM36-160 aa

Gene ID	Domain ID	Domain Name	Start aa	End aa	E-value	Score
LXL04_028733	`PF02365.21`	NAM	36	160	3.2e-45	154.3

Arabidopsis / Rice Protein Homology

Only Arabidopsis and rice are shown. Swiss-Prot entries are reviewed; TrEMBL entries are supplementary sequence candidates. Similarity is not experimental validation.

Download current result

Protein	Organism	Description	Identity	Database	Confidence
`Q9ZVP8`	Arabidopsis thaliana	NAC domain-containing protein 35	53.678%	Swiss-Prot	strong database homology
`Q9FIW5`	Arabidopsis thaliana	Putative NAC domain-containing protein 94	48.744%	Swiss-Prot	weak database homology
`Q9ZVH0`	Arabidopsis thaliana	Protein FEZ	51.765%	Swiss-Prot	weak database homology
`Q10S65`	Oryza sativa subsp. japonica	NAC domain-containing protein 22	55.844%	Swiss-Prot	weak database homology

JBrowse

View in Genome Browser

Gene Card