LXL04_028282 | RubberDandelionOmics

Gene overview

LXL04_028282

Reference: OH-1004 Chr: Chr06 Coordinates: 36681108-36681644 Strand: + Type: protein_coding

cDNA / CDS / Protein Sequences

Available sequence downloads CDS FASTA Protein FASTA cDNA FASTA

cDNA

363 bp · LXL04_028282|LXL04_028282|OH1004|cDNA

ATGGCCAAATACAATTGTAAAAAGTTGGTTTCCTCATCTTCTGCAACCGTCTATGGACAGCCGAAGAAAATTCCATGTGTTGAGGACTTTGAACTGAAAGCAATGAACCCATATGGGCGCACAAAGCTGTTCCTTGAAGAAATAGCTCGCGATATTCAAAATTCAGATCCAGAGTGGAAAATAATTTTACTCAGATACTTCAATCCTGTTGGAGCttatattataataattaatttatttttccAGCACTTAAAAAGGAA...

CDS

Download CDS FASTA

363 bp · LXL04_028282|LXL04_028282|OH1004|CDS

ATGGCCAAATACAATTGTAAAAAGTTGGTTTCCTCATCTTCTGCAACCGTCTATGGACAGCCGAAGAAAATTCCATGTGTTGAGGACTTTGAACTGAAAGCAATGAACCCATATGGGCGCACAAAGCTGTTCCTTGAAGAAATAGCTCGCGATATTCAAAATTCAGATCCAGAGTGGAAAATAATTTTACTCAGATACTTCAATCCTGTTGGAGCTTATATTATAATAATTAATTTATTTTTCCAGCACTTAAAAAGGAA...

Protein

Download Protein FASTA

120 aa · LXL04_028282|LXL04_028282|OH1004|PROTEIN

MAKYNCKKLVSSSSATVYGQPKKIPCVEDFELKAMNPYGRTKLFLEEIARDIQNSDPEWKIILLRYFNPVGAYIIIINLFFQHLKRNGMDLFLFHWMEWNQEWMEELRRNGIWNGMVKCS

Flanking Sequence Download

Sequence orientation and download details

Upstream/downstream are capped at 10000 bp per side. Negative-strand genes are reverse-complemented so the final FASTA follows transcriptional 5′→3′ orientation.

ID Mapping

Input ID	`LXL04_028282`
TK1151 ID	TkA02G609620
OH-1004 ID	LXL04_028282
Relationship / confidence	Multi Candidate From Tk1151 / Complex relationship
Protein identity (%)	98.300
Protein coverage (%)	TK1151 100.000 / OH-1004 100.000 Coverage and evidence Coverage is the aligned span of the best-scoring HSP divided by representative protein length. A homolog match does not establish functional validation.
Source version	OH-1004 / GCA_047496595.1_OSU_TarKok_2.0

Open Full ID Mapping

SNP / Indel variants and carrier samplesCRA009020 · OH-1004

Expand to load variant records for this gene.

Basic Information and Functional Annotation

Gene ID LXL04_028282

Location Chr06:36681108-36681644 (+)

Description Similar to UGE1: Bifunctional UDP-glucose 4-epimerase and UDP-xylose 4-epimerase 1

Arabidopsis / Rice Reference Genes and Papers

Download references for this gene

Arabidopsis

Reference gene ID	Possible function	Papers / DOI
`At1g12780`	Catalyzes the interconversion between UDP-glucose and UDP- galactose and the interconversion between UDP-arabinose and UDP-xylose.	Distinct properties of the five UDP-D-glucose/UDP-D-galactose 4-epimerase isoforms of Arabidopsis thaliana.2006 · DOI: 10.1074/jbc.m512727200 UDP-glucose 4-epimerase isoforms UGE2 and UGE4 cooperate in providing UDP-galactose for cell wall biosynthesis and growth of Arabidopsis thaliana.2007 · DOI: 10.1105/tpc.106.049619 Bifunctional cytosolic UDP-glucose 4-epimerases catalyse the interconversion between UDP-D-xylose and UDP-L-arabinose in plants.2009 · DOI: 10.1042/bj20091025
`At1g63180`	Catalyzes the interconversion between UDP-glucose and UDP-galactose and the interconversion between UDP-arabinose and UDP-xylose.	Distinct properties of the five UDP-D-glucose/UDP-D-galactose 4-epimerase isoforms of Arabidopsis thaliana.2006 · DOI: 10.1074/jbc.m512727200 UDP-glucose 4-epimerase isoforms UGE2 and UGE4 cooperate in providing UDP-galactose for cell wall biosynthesis and growth of Arabidopsis thaliana.2007 · DOI: 10.1105/tpc.106.049619 Bifunctional cytosolic UDP-glucose 4-epimerases catalyse the interconversion between UDP-D-xylose and UDP-L-arabinose in plants.2009 · DOI: 10.1042/bj20091025

Rice

No hit for this species in the current source table.

Functional annotation source

View annotation sources

Functional annotation source: OH1004 · LXL04_028282 · GCA_047496595.1_OSU_TarKok_2.0.

GO annotations (OH1004 source)

GO:0005996 monosaccharide metabolic process Biological Process

GO:0006012 galactose metabolic process Biological Process

GO:0009555 pollen development Biological Process

GO:0033358 UDP-L-arabinose biosynthetic process Biological Process

GO:0045227 capsule polysaccharide biosynthetic process Biological Process

GO:0046369 galactose biosynthetic process Biological Process

GO:0071555 cell wall organization Biological Process

GO:0005829 cytosol Cellular Component

GO:0005886 plasma membrane Cellular Component

GO:0003978 UDP-glucose 4-epimerase activity Molecular Function

GO:0046983 protein dimerization activity Molecular Function

GO:0050373 UDP-arabinose 4-epimerase activity Molecular Function

KEGG gene cross-reference

ath:AT1G12780

ath:AT1G63180

These KEGG gene identifiers are linked through homologous proteins; they do not establish pathway function for this gene.

Open Annotation Module

Gene expression

View expression in different studies, tissues and treatments. Results are presented separately by study and measurement unit.

View expression for this gene

Data sources and gene correspondence

Expression data come from public transcriptome studies. Reference genomes, sample metadata and measurement units are shown with the results. Ambiguous cross-reference correspondences do not select an expression record automatically; missing values do not mean zero expression.

Subcellular Localization Top 5

Computational predictions or homology annotations below do not replace localization experiments.

Cytoplasm0.363

Rank 1 · LXL04_028282 · OH-1004

Mitochondrion0.189

Rank 2 · LXL04_028282 · OH-1004

Nucleus0.185

Rank 3 · LXL04_028282 · OH-1004

Peroxisome0.174

Rank 4 · LXL04_028282 · OH-1004

Plastid0.095

Rank 5 · LXL04_028282 · OH-1004

LocPro · Direct prediction · Computational prediction, not experimental localization

Open Subcellular Module

Predicted Functional Domains

Domain results are from Pfam-A/HMMER; positions are amino-acid coordinates on the protein sequence.

PF01370.28Epimerase1-73 aa

PF16363.12GDP_Man_Dehyd4-72 aa

Gene ID	Domain ID	Domain Name	Start aa	End aa	E-value	Score
LXL04_028282	`PF01370.28`	Epimerase	1	73	2e-13	51.1
LXL04_028282	`PF16363.12`	GDP_Man_Dehyd	4	72	2.3e-11	44.5

Arabidopsis / Rice Protein Homology

Only Arabidopsis and rice are shown. Swiss-Prot entries are reviewed; TrEMBL entries are supplementary sequence candidates. Similarity is not experimental validation.

Download current result

Protein	Organism	Description	Identity	Database	Confidence
`Q42605`	Arabidopsis thaliana	Bifunctional UDP-glucose 4-epimerase and UDP-xylose 4-epimerase 1	86.301%	Swiss-Prot	moderate database homology
`Q8LDN8`	Arabidopsis thaliana	Bifunctional UDP-glucose 4-epimerase and UDP-xylose 4-epimerase 3	83.562%	Swiss-Prot	moderate database homology

JBrowse

View in Genome Browser

Gene Card